KEGG   Gallus gallus (chicken): 769222
Entry
769222            CDS       T01006                                 

Gene name
ADAMTS8
Definition
(RefSeq) A disintegrin and metalloproteinase with thrombospondin motifs 8
  KO
K08623  a disintegrin and metalloproteinase with thrombospondin motifs 8 [EC:3.4.24.-]
Organism
gga  Gallus gallus (chicken)
Brite
KEGG Orthology (KO) [BR:gga00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:gga01002]
    769222 (ADAMTS8)
Enzymes [BR:gga01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.24  Metalloendopeptidases
    3.4.24.-  
     769222 (ADAMTS8)
Peptidases and inhibitors [BR:gga01002]
 Metallo peptidases
  Family M12: astacin/adamalysin family
   769222 (ADAMTS8)
SSDB
Motif
Pfam: ADAM_spacer1 TSP1_ADAMTS Reprolysin ADAM_CR_2 TSP_1 Reprolysin_5 Pep_M12B_propep Reprolysin_3 TSP1_spondin Reprolysin_2 TSP1_CCN Reprolysin_4
Other DBs
NCBI-GeneID: 769222
NCBI-ProteinID: XP_015153616
CGNC: 938
Ensembl: ENSGALG00000001370
UniProt: A0A1D5PVG5
Position
24
AA seq 903 aa
MGRRALLGGRAPLHLLLLCHAWALPPPPREAQPLLPARLPAPPGQLALRLAAFGRAVVLR
LRPDASFLAPRLRLQRLGGRRPPGRAAPRRGCFYAGTVEGRPDAPAVLSRCGAGLRAAFL
LDGAAYALQPLGPPAPGPPWRRPHRLQRRAAPPAPTRARPRPEAAPGQPLRRARRFVSEA
RYVETLLVADASMVRFYGEDVENHILTLMSMAARIYKHPSLKNAISLVVVKVLVVDEEAA
GPEVSDNGGLTLRNFCSWQQQFNPLSDRHPEHYDTAILLTRQDFCGHQGCDTLGVADIGT
MCDRNKSCSVIEDEGLQAAYTLAHELGHVLSMPHDDSKTCERLFGPLGKHHMMAPLFVHL
NKSQPWSPCSAMYLTEFLDGGHGDCLLDPPAQALSLPSELPGRGALYSLDQQCQQIFGKD
FQHCPNTTEEDVCAQLWCRTSSGEPLCHTKNGSLPWADGTPCMAGGLCWDGACLPQDALQ
PQPAVDGGWGAWSPWGSCSRTCGGGVQFSHRHCDHPRPQHGGRYCEGQRTRYQSCHTEEC
PQDGKSFREQQCEKYNSYNFTDLEGNRLEWVPKYAGVSPRDRCKLFCRARGRSEFKVFEP
KVIDGTLCGPETLSICVHGQCIKAGCDHVVGSSKKLDKCGVCGGNGSTCRKISGSLNRSK
YGYNDIVTIPAGATNIDIKQRSHRGVRHDGNYLALRTLEGRYLLNGDFAISAMEQDILIK
GTILKYSGSMTTLERLQSFRQLPEPLTVQLLTIASEVFPPKVKYTFFIPKDIPFSKQKDK
EKKSANVIRPMLTSQWVLGDWSECSKTCGSGWQRRTVECRDVEGQPSATCDRALKPEDIK
PCGDVPCPLWRMGPWSPCSQTCGEGVRTRNASCIHYTGTVIAPEKCSSPGPPPATATCLL
RQC
NT seq 2712 nt   +upstreamnt  +downstreamnt
atggggcggcgggcgctgctgggcgggcgggctccgctccacctgctgctgctgtgccac
gcctgggcgctgcctccgccgccgcgggaggcgcagccgctgctgcccgcccgcctgccc
gctccgccgggacagctggcgctgcgcctggccgctttcggccgcgccgtcgtgcttcgc
ctccgacccgacgcctctttcctcgccccgcgcctccgcctgcagcgcttgggaggccga
cggccgccgggccgggccgctcctcggcggggctgcttctacgccgggaccgtcgaaggg
cgtcccgacgctcccgccgtgctcagccgttgcggtgccgggctccgcgccgccttcctg
ctcgacggggcggcgtacgccctgcagcctctcgggccgcccgctcccggcccgccctgg
cgccgcccgcaccgcctccagcgccgcgccgccccgccggccccgacccgcgcgcggccc
cggcccgaagccgctcctgggcagccgctccgccgcgcccggcgcttcgtctccgaggcg
cgctacgtggagaccttgctggtggccgatgcgtccatggtgcgcttctacggggaggac
gtggagaaccacatcctgaccctgatgtccatggcagctcgcatctacaagcaccccagc
ctgaagaatgccatcagcctggtggtggtgaaggtgctggtggtggatgaggaggcagca
gggccggaggtgtcggacaacggtggccttaccctacgcaacttctgcagctggcagcag
cagttcaacccgctgagcgaccggcaccccgagcactatgacactgccatcctgctcacc
cgacaggatttctgcgggcatcaaggctgcgacacgctgggggtggcagatattggcacc
atgtgtgaccgcaacaaaagctgctcggtgatcgaggatgagggactgcaggctgcctac
acgctggctcacgagctgggccacgtgctcagcatgccccacgacgactccaagacctgt
gagcggctcttcgggcccctgggcaagcaccatatgatggccccgctctttgtccacctg
aacaagagtcagccctggtccccgtgcagtgccatgtacctcactgagttcctggacgga
gggcacggtgactgcttacttgatcccccagcccaagccctctccttgccctcggagcta
cctggccgaggggccctgtacagcctggaccagcaatgccagcagatctttggcaaagac
ttccagcactgccccaacaccacggaggaggacgtctgtgcccagctgtggtgtaggacc
agcagtggagagccgctgtgccacaccaagaacggcagcctgccctgggctgacggcacc
ccctgcatggcaggcgggctgtgctgggatggagcctgcctgccacaggatgctctgcag
ccccagccggcggtggatggcggctggggcgcgtggagcccgtggggttcgtgctcacgg
acgtgtgggggcggcgtgcagttctcccaccgccactgtgaccatccccggccccagcac
ggcggccgctactgcgagggccaacgcacccggtaccagtcgtgccataccgaggagtgc
ccgcaggacggcaagagctttcgggagcagcagtgtgagaagtacaacagctacaacttc
acggatctggaggggaaccggctggagtgggtccccaaatacgccggggtgtccccccgg
gaccgctgcaagctcttctgccgagccaggggaaggagcgagtttaaagtctttgagccc
aaagtgatagatgggacgctgtgtggtccagagaccctgtccatctgtgtgcacgggcag
tgcatcaaggctggctgcgaccacgttgttgggtcctccaagaaactggacaagtgtggg
gtgtgcggcggcaacggctcaacctgcaggaaaatatccggctcactcaaccgatccaag
tatggctacaatgacatcgtcaccatcccggctggggcaaccaacattgacatcaagcag
cgcagccaccgtggggtgcgccacgatgggaactacctggccctgaggaccctggagggc
aggtacctgctgaacggcgacttcgccatctcagccatggagcaggacatcctcattaag
ggcaccatcctcaagtacagcggctccatgacgaccctggagaggctgcagagcttccgg
cagctcccggagcccctgaccgtccaactgctgaccatcgccagcgaggtcttcccaccc
aaagtcaagtacaccttcttcatccctaaagacatccccttcagcaagcagaaagacaaa
gagaagaagtcggccaacgtcatccgcccgatgctcacctcgcagtgggtgctgggcgac
tggtccgagtgctccaagacctgcggctctggctggcagaggcggacggtggagtgccgg
gatgtcgaaggccaaccttcagccacctgcgaccgagccctcaagcctgaggacatcaaa
ccctgcggtgacgtcccctgcccgctctggcgcatgggtccttggtcgccgtgctcccag
acgtgtggcgagggcgtgcggacgcgcaacgcttcctgcatccactacaccggcaccgtc
atcgccccggagaaatgcagctccccggggccaccgccagccactgccacctgcctgctg
cggcagtgctga

DBGET integrated database retrieval system