KEGG   Gallus gallus (chicken): 769254
Entry
769254            CDS       T01006                                 

Gene name
CBLN4
Definition
(RefSeq) cerebellin-4 precursor
  KO
K24235   
Organism
gga  Gallus gallus (chicken)
SSDB
Motif
Pfam: C1q
Other DBs
NCBI-GeneID: 769254
NCBI-ProteinID: NP_001072955
CGNC: 5877
Ensembl: ENSGALG00000030821
UniProt: Q5ZI01
Position
20
AA seq 196 aa
MGWRLLPAVLLALALGGPAARAQNETEPIVLEGKCLVVCDSNPTTDAKGSSSSPLGISVR
AANSKVAFSAVRSTNHEPSEMSNKTRIIYFDQILVNVGNFFTLESVFVSPRKGIYSFSFH
VIKVYQSQTIQVNLMLNGKPVISAFAGDKDVTREAATNGVLLYLDKEDKVYLKLEKGNLV
GGWQYSTFSGFLVFPL
NT seq 591 nt   +upstreamnt  +downstreamnt
atgggctggcggctgctgcccgccgtgctcctggccctggcgctgggcggccccgcggcg
cgggcgcagaacgagacggagcccatcgtcctagagggcaagtgcctggtggtgtgcgat
tccaacccgaccaccgacgccaagggctcgtcctcctccccgctgggcatctcggtgagg
gcggccaactcgaaggtcgccttctcggcggtcaggagcaccaaccacgagccctccgag
atgagcaacaagacgcgcatcatctacttcgaccagatcctagtaaacgtgggcaatttt
ttcacgttggaatctgtctttgtgtcaccaagaaaaggaatttacagcttcagttttcac
gtgattaaagtctaccagagccaaacaatccaggttaacttgatgctcaatgggaagcca
gtcatctctgcttttgctggggacaaggacgtcactcgtgaagctgccactaacggagtc
ctgctctatctagacaaggaggataaggtttacctgaagctggagaaaggtaatctggtt
ggtggatggcagtattctacgttttctggctttctggtctttcccctgtaa

DBGET integrated database retrieval system