KEGG   Gallus gallus (chicken): 769595
Entry
769595            CDS       T01006                                 

Gene name
WTIP
Definition
(RefSeq) Wilms tumor protein 1-interacting protein
  KO
K16682  LIM domain-containing protein
Organism
gga  Gallus gallus (chicken)
Brite
KEGG Orthology (KO) [BR:gga00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:gga03019]
    769595 (WTIP)
   03036 Chromosome and associated proteins [BR:gga03036]
    769595 (WTIP)
Messenger RNA biogenesis [BR:gga03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   mRNA cycle factors
    Common to processing body (P body) and stress granule
     769595 (WTIP)
Chromosome and associated proteins [BR:gga03036]
 Eukaryotic type
  Sister chromatid separation proteins
   Aurora kinases
    Regulators of Aurora kinases
     769595 (WTIP)
SSDB
Motif
Pfam: LIM
Other DBs
NCBI-GeneID: 769595
NCBI-ProteinID: XP_001232879
CGNC: 3688
Ensembl: ENSGALG00000025864
UniProt: R4GGZ7
Position
11
AA seq 691 aa
MEKYEENMALKATKFMEDLSLYEPCPDAPYGRGGRRDLPLHPDLEETKRVIAAHMTAEQR
GRKMNGTAAPPPPAEAFPAAAPCGKAAPLRAANGRPAAEPPCCEEGLCTRSEVALPCYSG
FPDKGKRYSAEGYRYAAGSAYEGGYVAKGGGRAPGGPDAKYGNASPRASLAAPPGPGPGA
EHGKFSSPRSSLGGAAALPYEKFSSPRSSLVVPGQEKYGSPRGSLVQYDGAALSPRSSYA
STASDTSKHSSPRASLTSYDGGSKPSSNRTSGISMGYDQRHASPRSSTASQYSCTTSPRS
SYSDSRYGPPGGAELDGAAAAGLVVASPRSSLCSPEGRGAPGAAVVSPRSSISSQSSRSS
RGSMSAYPELQLPSPRSSLLGPGPQEDCAVPELGDVYRKVRAQSPPRHDPQHPAAAGPDA
APPYAYSPTKGSASAPKFKLPYQVTPCRDSGPSQAERRLEALTLELEKELEMHMKKEYFG
ICIKCGKGVYGASQACQAMGNLYHTNCFTCCSCGRRLRGKAFYNVNGKVYCEEDFLYSGF
QQTADKCFVCGHLIMEMILQALGKSYHPGCFRCVVCNECLDGVPFTVDVENNIYCVKDYH
TVFAPKCASCNQPILPAQGSEETIRVVSMDKDYHVECYHCEDCGLQLNDEEGHRCYPLEG
HLLCHGCHIRRLNIKLPSHPPPSYPMHVTEL
NT seq 2076 nt   +upstreamnt  +downstreamnt
atggagaagtacgaggagaacatggcactgaaggccaccaagttcatggaggacctgtcc
ctctacgagccctgtccggacgctccctacggccggggcggccgccgagacctaccgctg
caccccgacctggaggagaccaagcgggtcatcgccgcccacatgacggcggagcagcgg
ggccggaagatgaacggcaccgccgcgccgccgccgcccgccgaagccttccccgccgcc
gccccctgcggtaaagccgccccgctccgcgccgccaacgggcgccccgccgccgagccg
ccgtgctgcgaggaggggctgtgcacccgctccgaggtggcgctgccctgctacagcggc
ttccccgacaagggcaagcgctactcggccgagggctaccgctacgccgcgggcagcgcc
tacgagggcggctacgtggccaagggcggcgggcgggctcccggcggcccggacgccaag
tacggcaacgccagcccccgcgccagcctggccgccccgccgggcccgggccccggcgcc
gagcacggcaagttctccagcccgcgctccagcctgggcggcgcggccgcgctgccctac
gagaagttttccagcccccgctccagcctggtggtgcccggccaggagaagtacggcagc
ccccgcggcagcctggtgcagtacgacggggccgctctcagccctcgctccagctacgcc
agcacggccagcgacaccagcaagcactccagcccccgtgccagcctcaccagctacgac
ggcggcagcaaacccagcagcaaccgcaccagcggcatcagcatgggctacgaccagcgg
cacgccagcccccgctccagcaccgccagccagtactcgtgcaccaccagcccgcgctcc
agctactcggactccagatacgggccgccgggcggcgccgagctggacggggcggccgcc
gccgggctcgtcgtggccagcccccgctccagcctctgcagccccgagggccgcggcgcg
ccgggcgccgccgtggtcagcccccgctccagcatctccagccagagctcgcggagctcc
cgcggctccatgagcgcctaccccgagctgcagctgccctcgccccgctcctccctactg
gggcccggcccgcaggaggactgcgccgtgcccgagctgggggacgtctaccgcaaggtc
cgtgcccagtctccgccgcggcacgacccgcagcacccggcggccgccgggcccgacgcc
gcgcccccctacgcgtacagccccaccaagggctccgcttcggcgcccaagttcaagctg
ccgtaccaggtgacgccgtgccgggacagcggccccagccaggcggagaggcggctggag
gcgctgacgctggagctggagaaggagctggagatgcacatgaagaaggagtacttcggt
atttgtataaaatgtggaaaaggtgtgtatggagcgagccaggcttgccaagcaatgggt
aacctctatcataccaactgcttcacgtgctgctcttgtgggagaagactacgaggaaaa
gcgttctacaatgtcaatggcaaggtgtactgtgaagaagacttcctatattcgggtttc
cagcaaacagcagataagtgctttgtttgtggacacctcataatggaaatgatcttacag
gcccttggaaagtcataccaccctggctgcttccgctgcgtggtatgtaacgagtgtttg
gatggagtccccttcactgtagatgtggagaacaatatttactgtgtcaaagactaccat
acggtttttgcaccaaaatgcgcttcctgtaaccagccgattcttccagcacagggatct
gaagaaaccatccgagtagtgtcaatggacaaagactaccacgtggagtgctatcactgt
gaggattgtggcttgcagctcaatgatgaggaaggccatcgttgttacccattagagggc
cacttgctctgtcacggctgtcatatcagacgccttaatattaaattgccatcacatcca
ccaccgagctatccaatgcacgttacagaactctga

DBGET integrated database retrieval system