KEGG   Gallus gallus (chicken): 769661
Entry
769661            CDS       T01006                                 

Gene name
ATF7
Definition
(RefSeq) cyclic AMP-dependent transcription factor ATF-7 isoform X1
  KO
K09045  activating transcription factor 7
Organism
gga  Gallus gallus (chicken)
Brite
KEGG Orthology (KO) [BR:gga00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:gga03000]
    769661 (ATF7)
Transcription factors [BR:gga03000]
 Eukaryotic type
  Basic leucine zipper (bZIP)
   AP-1(-like) components, CRE-BP/ATF
    769661 (ATF7)
SSDB
Motif
Pfam: bZIP_1 bZIP_2 bZIP_Maf zf-C2H2 Cnn_1N
Other DBs
NCBI-GeneID: 769661
NCBI-ProteinID: XP_003643883
CGNC: 2200
Position
33
AA seq 480 aa
MGDDRPFVCNAPGCGQRFTNEDHLAVHKHKHEMTLKFGPARTDSVIIADQTPTPTRFLKN
CEEVGLFNELASSFEHEFKKAAEDEEKKSTAALDMSLPSTPDIKIKEEEPVEVDSSPPDS
PASNPRSPQTKEKEITPKPVIISTPTPTIVRPGSLPLHLGYDPLHPTLPSPTSVITQAPP
SNRQLGSPTGSLPLVVQLPNGQTMPVLPGPPMQMPSVISLARPVSIVPNIPGIPGPPSSS
SGSVSPPGLPVHSEAKMRLKASLTASSSLNGSSLVVGSASTMVTARPEQSQILVQHPDAP
SPAQPQVSPAQPTPSTGGRRRRTVDEDPDERRQRFLERNRAAASRCRQKRKLWVSSLEKK
AEELTTQNIQLSNEVTLLRNEVAQLKQLLLAHKDCPVTALQKKTQGYLESPKESSEPTGS
PAPVIQHSSVTASPNGLSVRSAAEAVATSVLTQMANQRTELALPLQPHVIMAPQSQSAGR
NT seq 1443 nt   +upstreamnt  +downstreamnt
atgggcgacgacagacccttcgtgtgcaacgcccccggctgcggacagaggtttacaaac
gaggaccacctggctgttcataaacacaaacatgagatgacattgaaattcggccccgcg
cgcaccgactcggtcatcatcgcagatcagaccccgacgccgactcggttcctgaagaac
tgcgaggaggtggggctgttcaacgagctggcaagctccttcgagcacgagttcaagaaa
gccgccgaggatgaggagaaaaagagcactgcagccctggacatgtcgctgccctccacc
ccagacatcaagataaaggaggaggagccggtggaggtggactcgtcccccccagacagc
cctgcctccaacccacggtcaccgcagaccaaggagaaggagatcacccccaagcccgtg
atcatttccacaccaacaccaaccatcgtgcgccccggatcgctgcccctgcacctgggc
tacgaccccctgcaccccacgctgccttccccaacctccgtcatcacccaggccccgccg
tccaacaggcagctcgggtcgcccacgggttcccttccgctcgtcgtgcagctgccaaac
gggcagaccatgcctgtcctgcccggcccccccatgcagatgccgtctgtgatatcgctg
gcccggcccgtctccatcgtgcccaacattcccggcatccccgggccgcccagcagcagc
agcggctccgtttcccctccgggtctccccgtgcactcggaagccaaaatgaggctgaag
gccagcttgacggcgtcttcctcgctgaacggcagcagcctggtggtgggctcagccagc
acgatggtgaccgcgcgcccggagcagagccagatcctcgtccagcaccccgacgctcca
tcgccagctcagcctcaggtttcccctgcccaacccacccccagcaccggcggccggcgg
aggcggacggtggatgaggaccccgatgagcgccggcagcggttcctggagcggaacaga
gctgctgcctcacgctgccggcagaaacgcaagctgtgggtgtcctccttggagaagaaa
gccgaggagctcacaacgcagaacatccagctgagcaatgaagtgacgctgctgaggaat
gaggtggctcagctgaagcagctgctgctggctcacaaggactgccccgtcaccgcgctg
cagaagaagacccagggctacctcgaaagccccaaggagagctccgagcccaccggctcc
ccggcgcccgtcatccagcacagctccgtcaccgcctcccccaatgggctcagcgtccgc
tcggcagccgaggccgtggccacgtcggtgctgacgcagatggcgaaccaaaggacagag
ctggccctgcccctgcagccgcacgtcatcatggccccacagtcgcagtctgcgggcaga
tga

DBGET integrated database retrieval system