KEGG   Gallus gallus (chicken): 769673
Entry
769673            CDS       T01006                                 

Gene name
ERNI
Definition
(RefSeq) uncharacterized protein LOC769673
Organism
gga  Gallus gallus (chicken)
SSDB
Motif
Pfam: TEX13 DUF4407 TBCA
Other DBs
NCBI-GeneID: 769673
NCBI-ProteinID: NP_001074343
CGNC: 55442
UniProt: Q9I8S1
Position
5
AA seq 490 aa
MSNSMASMKSEDVLFDLLEKHGARPSVSGVDWARQNWYNLQSVSDRIRVLQNEARTRAGK
GKSFICAVLGAALKAAVEFREEKNSTETQTIQALQESVKVTQELVKSLQSQITSLEDQLE
REKHNSVLLQTAFKELITCKDTGDTVAHSAPQEKVYPQGKLQEVKERLDKLEASPAHIRP
LIKTEYTFDNSEDLDPQMNVKEIPFSATELAKLKKDFSRSPKESETEYVWRVSLTGGDQI
LLTEKEAEGYWGPGVFLTTGNNRAPWSLTQRAAYWAGGLNPLERGDPLAITGTIDQLVEN
VQKAACLQMMYDRKLQLHHESPMMLPVNPERLTPLIRGLPESLKPIGIQLQGKIQAMSQG
ERTWAALEGSVTPNHQSGSKVWTWGEVAQELINYGRKYGPVVSTSSKFEPRGVRLAVANL
TSRPPSPKLNETKKVSSPVKTGTRCIDHKRNGLWTLGWRKGIPRDLMNGLPTVRLEKLVN
CWPEQKLKGS
NT seq 1473 nt   +upstreamnt  +downstreamnt
atgagcaacagtatggccagtatgaaaagtgaagatgtattatttgatcttttagaaaag
catggtgctcggccttctgtatcaggggtggattgggcacgacagaactggtataatttg
caaagtgtttcagaccgtattcgtgttttacaaaatgaggctcgtactcgggccggaaaa
gggaaatcttttatttgtgcagtactcggtgctgctttaaaagcagctgtggagttccga
gaggaaaagaactctacggaaacccagactattcaagcattacaggaatcggttaaagtg
acgcaagaattggtaaaatctctgcaaagccaaataacgagtcttgaggatcaattagaa
agagaaaaacataattcggttctgttgcaaacagcttttaaggagctgataacgtgtaag
gacaccggtgacactgtcgcccacagtgcacctcaagaaaaagtttatcctcaagggaaa
ttacaagaggtgaaggaaaggctagataaattagaggcctctccagcccacattcgtcct
ttgataaaaactgaatatactttcgataacagtgaggatctagatcctcaaatgaatgtt
aaggaaattcccttttcagccactgaactggccaaactgaaaaaggatttcagtcgctcc
ccaaaggagtctgaaacagagtacgtctggagagttagtctcactggcggagaccagatc
ctactaacagagaaagaagctgaaggttactggggaccaggagtatttttaaccactggc
aataatcgtgctccctggtccttaacacagagggctgcctattgggcagggggtctcaac
cctttagaaaggggggaccctcttgctattaccggaactatcgaccagttagtggagaat
gttcagaaagctgcttgtctccaaatgatgtatgatagaaagttgcagctacatcatgaa
tcacccatgatgttacctgttaatccggagagactgacacctctaatcaggggacttcct
gaatcgttaaaacctataggtatacaactccaaggaaagatacaagccatgtctcaggga
gagagaacctgggcagcgttggagggatctgtaactcctaaccaccagtcaggatctaaa
gtgtggacttggggagaggttgcccaagaattaattaactacggaagaaaatatgggccg
gtggtttctacctccagtaaatttgagccaagaggagtaaggcttgcagtagccaacctt
acctccaggccacctagcccaaaacttaatgaaaccaaaaaggtttcatccccagtaaaa
acggggacacgatgcattgatcataaacgcaacggactttggactctgggctggagaaag
ggtattccacgagatttgatgaatggattacccacagtcagattagagaaattagttaac
tgctggccagaacaaaagctcaaggggagctga

DBGET integrated database retrieval system