KEGG   Gallus gallus (chicken): 769770Help
Entry
769770            CDS       T01006                                 

Gene name
ATP6V0E2
Definition
(RefSeq) V-type proton ATPase subunit e 2
  KO
K02153  V-type H+-transporting ATPase subunit e
Organism
gga  Gallus gallus (chicken)
Pathway
gga00190  Oxidative phosphorylation
gga01100  Metabolic pathways
gga04145  Phagosome
Brite
KEGG Orthology (KO) [BR:gga00001]
 Metabolism
  Energy metabolism
   00190 Oxidative phosphorylation
    769770 (ATP6V0E2)
 Cellular Processes
  Transport and catabolism
   04145 Phagosome
    769770 (ATP6V0E2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: ATP_synt_H
Motif
Other DBs
NCBI-GeneID: 769770
NCBI-ProteinID: NP_001264316
CGNC: 14310
Ensembl: ENSGALG00000020754
UniProt: F1P345
Position
6
AA seq 81 aa AA seqDB search
MTAHSFALPLVLFSAFWGLVGIAAPWFVPKGPNRGVIITMLVTTAVCCYLFWLIAILAQA
NPLFGPQLKNETIWYVRFLWE
NT seq 246 nt NT seq  +upstreamnt  +downstreamnt
atgacggcgcacagtttcgcgctgcccctcgtcctcttctcggccttctggggcctggtg
ggcatcgccgccccctggttcgtgcccaaggggcccaaccgcggggtgatcatcacgatg
ctggtcaccacggccgtgtgctgctacctcttctggctcatcgctatcctggcccaggcc
aacccccttttcgggccgcagctgaagaacgagaccatctggtacgtgcgcttcctctgg
gagtga

DBGET integrated database retrieval system