KEGG   Gallus gallus (chicken): 769832
Entry
769832            CDS       T01006                                 

Gene name
CCDC3
Definition
(RefSeq) coiled-coil domain-containing protein 3
Organism
gga  Gallus gallus (chicken)
SSDB
Motif
Pfam: YscO ATG16 DUF3450 DUF812 Fib_alpha DUF489 KLRAQ Ax_dynein_light FlaC_arch TMCO5 GrpE Tropomyosin_1 Occludin_ELL DivIC Herpes_UL6 DUF1664 BLOC1_2 YabA DegS Atg14 Uso1_p115_C LMBR1 ZapB DUF3251 Exonuc_VII_L DUF4988
Other DBs
NCBI-GeneID: 769832
NCBI-ProteinID: XP_003640381
CGNC: 13134
Ensembl: ENSGALG00000030140
Position
1
AA seq 325 aa
MPPPAGPLLLLGLALGLGAGAGAGGGCQLPAEWRPLSEGCRAELASIIVYARVLALHPDP
YGAYNYLPWQRDPPSGASSQHNPGGLFYSAEIELLCDQAWGSMLEVPAGSRLNLTGLGYF
SCHSHTVMQGYAYFFFLRMDENYILLPHGVNFQEAIFPDTQENRRMFASLFQFSNCSQAQ
HALSFSSDWEIQEDNRLMCSSVQKALFEEEDRVKKLQQKVATLEKRNKQLRDRVKKVKRS
LRQARKNTRHMELMNRKLSEKLASAGGQIPYINSLKQETHMLPTLKYNARVMQEFRPMIM
ANFACVRSGSGPYTLSALLQTLHGK
NT seq 978 nt   +upstreamnt  +downstreamnt
atgccgccgcccgcggggccgctgctgctgctggggctggcgctggggctgggggccggg
gcgggcgccggggggggctgccagctgccggccgagtggcggccgctgagcgagggctgc
cgagccgagctggcttccatcatcgtttacgcgcgggtgttggctcttcaccccgatccc
tacggggcttacaattatctgccctggcaacgggaccccccctccggtgccagctcgcag
cacaacccgggaggactcttttattcggctgagatcgagctgctgtgcgaccaagcgtgg
ggcagcatgctggaggtgcccgccggctcccgactcaacctcaccgggctcggctacttc
tcctgtcactcgcacaccgtcatgcagggctacgcttacttcttcttccttcgcatggat
gagaattacatcctcctgccgcatggggtgaactttcaggaggcgattttcccggacacc
caggagaacaggaggatgtttgccagccttttccagttttccaactgctcgcaggcacag
cacgccctgagcttctccagcgactgggagatccaagaagacaatcgactcatgtgctcc
tcggtccagaaagccctgtttgaggaggaggacagagtgaagaagcttcagcagaaggtg
gcaacattggagaagcgcaacaaacagctgcgagatcgggtgaagaaagtcaagaggtct
ctccggcaagctaggaaaaataccaggcacatggagttgatgaacagaaagctcagtgag
aaacttgcctctgcaggtggtcaaattccctatattaactctttaaagcaggaaactcac
atgctacctaccttaaagtataatgcaagggtaatgcaagagttcaggccaatgataatg
gcaaattttgcctgtgttagatcaggatctggcccttacaccttgtctgcactgcttcaa
accttgcatggaaaatga

DBGET integrated database retrieval system