KEGG   Gallus gallus (chicken): 770044
Entry
770044            CDS       T01006                                 

Gene name
CEND1
Definition
(RefSeq) cell cycle exit and neuronal differentiation protein 1
Organism
gga  Gallus gallus (chicken)
SSDB
Motif
Pfam: CEND1 Alpha_GJ
Other DBs
NCBI-GeneID: 770044
NCBI-ProteinID: NP_001180192
CGNC: 3841
Ensembl: ENSGALG00000032320
UniProt: A0A1D5NYW9
Position
5
AA seq 130 aa
MDSKGNVRSANKPDAKAPSSGKSEKPSPGPATNADKKETPKEQPNPATAPKKAGSDAAVV
NNHSNLKPSAAATETQEAIGQSPDSDHKGNGSEESPGSIFDNMKPLIIVGGVAVAALAVI
VGVAFLARKK
NT seq 393 nt   +upstreamnt  +downstreamnt
atggattccaaaggtaacgtccgaagtgccaacaaacccgatgccaaggcccccagctct
ggaaagtcagaaaagcccagccctgggcctgccactaatgcagacaagaaggagaccccc
aaagagcagcctaatcctgccactgctcccaagaaggccggcagcgacgctgctgtcgtg
aacaaccacagcaacctgaaacccagtgcagctgccacggagacacaagaggccattggc
cagtcccctgactctgaccacaagggaaatggctccgaggagtcaccgggcagcatcttc
gacaacatgaagcccttgatcatcgttggaggagtggcggtggcggcgctggcggtgatt
gtgggagtggcgttcctagcccggaaaaaatga

DBGET integrated database retrieval system