KEGG   Gallus gallus (chicken): 770254
Entry
770254            CDS       T01006                                 

Gene name
KLF4
Definition
(RefSeq) Krueppel-like factor 4
  KO
K17846  krueppel-like factor 4
Organism
gga  Gallus gallus (chicken)
Brite
KEGG Orthology (KO) [BR:gga00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:gga03000]
    770254 (KLF4)
Transcription factors [BR:gga03000]
 Eukaryotic type
  Zinc finger
   Cys2His2 developmental/cell cycle regulators, Krueppel-like
    770254 (KLF4)
SSDB
Motif
Pfam: zf-C2H2 zf-H2C2_2 zf-C2H2_4 zf-C2H2_8
Other DBs
NCBI-GeneID: 770254
NCBI-ProteinID: XP_004949426
CGNC: 28582
Ensembl: ENSGALG00000026928
Position
Z
AA seq 458 aa
MRQPPGECEMALSGTLLPSIATFAAGAAGREKAPRPAGPGNRWREELSQLKRPPPALTAR
PAEPPPSDLETAPALGPRRETEEFNELLDFDFILSNSLMHQEPAAAAAVVVSPAAAPAPA
ASPCPAGPFAYPLPCAEPGGLLYGGGGGGGGGRDGAPAAAPFNLADISDVSPSGGFVAEL
MRPDLDPVYLPAPAALPPLGSLQGKFVVKAVGDYSHPGLSPKSGPPAAAQPPGSEGPGAP
YSPLQPRMCPKIKQEASPPCTLAPPPHGSGPRGPPPQHDFSMGRLLPARTTPSLGPEEML
SSRDCLPPTPGLGHPPLPLPPGYPPAPGYPTFLPEQLPPGTLQYQELMPPGSCLPEETKP
KRGRRSWPRKRTATHTCDYAGCGKTYTKSSHLKAHLRTHTGEKPYHCDWEGCGWKFARSD
ELTRHYRKHTGHRPFQCQRCDRAFSRSDHLALHMKRHF
NT seq 1377 nt   +upstreamnt  +downstreamnt
atgcggcagccccccggcgagtgcgagatggcgctcagcggcacgctcctcccctccatc
gccaccttcgcggcgggcgccgcgggccgcgagaaggcgccgcggcccgcgggccccggc
aacaggtggcgggaggagctgtcgcagctgaagcggccgccgccggcgctgacggcgcgt
cccgcggagccgccgccgtcggacctggagaccgcgcccgccctggggccgcgccgtgaa
accgaggagttcaacgagctgctggatttcgacttcatcctctccaactccctcatgcac
caggagcccgccgccgccgccgcggtggtggtgtcccccgccgccgccccggcccccgcc
gccagcccctgccccgccgggcccttcgcttacccgctgccctgcgccgagcccggcgga
ctcctctacggcggcggcggcggcggtggtggcggccgcgatggggctcccgccgccgct
cccttcaacctggcggacatcagcgacgtgtcgccctcgggaggcttcgtggccgagctg
atgcggcccgacctggacccggtgtacctgccggcgcccgccgccctaccgccgctgggc
agcctgcagggcaagttcgtggtgaaggccgtgggcgactacagccacccggggctcagc
cccaagagcggcccccccgccgccgcccaaccgcccggctccgagggacccggggctcct
tacagccccctccagccgcggatgtgccccaaaatcaagcaggaggccagcccgccctgc
acgctggccccgccgccgcacgggagcggcccccgaggaccccccccgcaacacgacttc
tccatgggccgcctgctgccggcccggactacgccctcgctggggcccgaggagatgctg
agcagcagggactgccttccccccacgccggggctcggccacccgccgttgccgctgccc
cccgggtatcccccggcccccggctacccgaccttcctgcccgagcagctgccccccggc
acgctgcagtaccaagagctgatgccgccggggagctgcctgccagaggagacaaagccc
aagaggggacggcggtcatggcctcgaaaaagaacagccactcacacctgtgactacgca
ggctgcggcaagacctacaccaagagctctcatctcaaggcacacctgagaacccacaca
ggtgagaaaccttatcactgtgactgggaaggctgcggatggaagtttgcccgatctgat
gaacttactcgtcattaccgaaaacacacgggccaccgccctttccagtgccagcggtgt
gacagagcattttccaggtcggatcacctcgccttacacatgaagaggcacttttaa

DBGET integrated database retrieval system