KEGG   Gallus gallus (chicken): 770267Help
Entry
770267            CDS       T01006                                 

Gene name
HIST1H2B7L4
Definition
(RefSeq) histone H2B 1/2/3/4/6
  KO
K11252  histone H2B
Organism
gga  Gallus gallus (chicken)
Brite
Chromosome and associated proteins [BR:gga03036]
 Eukaryotic Type
  Nucleosome assembly factors
   Histones
    770267 (HIST1H2B7L4)
Exosome [BR:gga04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   770267 (HIST1H2B7L4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Histone CBFD_NFYB_HMF TFIID_20kDa YscO-like
Motif
Other DBs
NCBI-GeneID: 770267
NCBI-ProteinID: XP_001233337
CGNC: 55899
Ensembl: ENSGALG00000027594
UniProt: P0C1H3
Structure
PDB: 

Position
1
AA seq 126 aa AA seqDB search
MPEPAKSAPAPKKGSKKAVTKTQKKGDKKRKKSRKESYSIYVYKVLKQVHPDTGISSKAM
GIMNSFVNDIFERIAGEASRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVT
KYTSSK
NT seq 381 nt NT seq  +upstreamnt  +downstreamnt
atgcctgagccggccaagtccgcgcccgccccgaagaagggctccaagaaggcggtcacc
aagacccagaagaagggcgacaagaagcgcaagaagagccgcaaggagagctactcgatc
tacgtgtacaaggtgctgaagcaggtgcaccccgacacgggcatctcgtccaaggccatg
ggcatcatgaactcgttcgtcaacgacatcttcgagcgcatcgccggcgaggcgtcgcgc
ctggcgcactacaacaagcgctcgaccatcacgtcgcgggagatccagacggccgtgcgg
ctgctgctgcccggcgagctggccaagcacgcggtctccgagggcaccaaggcggtcacc
aagtacaccagctccaagtag

DBGET integrated database retrieval system