KEGG   Gallus gallus (chicken): 770344
Entry
770344            CDS       T01006                                 
Symbol
AGXT
Name
(RefSeq) serine--pyruvate aminotransferase
  KO
K00830  alanine-glyoxylate transaminase / serine-glyoxylate transaminase / serine-pyruvate transaminase [EC:2.6.1.44 2.6.1.45 2.6.1.51]
Organism
gga  Gallus gallus (chicken)
Pathway
gga00250  Alanine, aspartate and glutamate metabolism
gga00260  Glycine, serine and threonine metabolism
gga00630  Glyoxylate and dicarboxylate metabolism
gga01100  Metabolic pathways
gga01200  Carbon metabolism
gga04146  Peroxisome
Brite
KEGG Orthology (KO) [BR:gga00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    770344 (AGXT)
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    770344 (AGXT)
   00260 Glycine, serine and threonine metabolism
    770344 (AGXT)
 09140 Cellular Processes
  09141 Transport and catabolism
   04146 Peroxisome
    770344 (AGXT)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:gga01007]
    770344 (AGXT)
Enzymes [BR:gga01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.44  alanine---glyoxylate transaminase
     770344 (AGXT)
    2.6.1.45  serine---glyoxylate transaminase
     770344 (AGXT)
    2.6.1.51  serine---pyruvate transaminase
     770344 (AGXT)
Amino acid related enzymes [BR:gga01007]
 Aminotransferase (transaminase)
  Class V
   770344 (AGXT)
SSDB
Motif
Pfam: Aminotran_5 Aminotran_1_2
Other DBs
NCBI-GeneID: 770344
NCBI-ProteinID: XP_003641783
CGNC: 14369
Ensembl: ENSGALG00000020943
Position
9:5044851..5047988
AA seq 416 aa
MHRAAALPISIAALLRACSTAGRAMAASTPFLPPPRELLRPLAVPYRLLLGPGPSNVSPR
VRAAGGQQILGHMHPEVLQAMDEIKAGIQYAFQTRNRLTLAISGTGHCAMEAALLNLLEG
SDTVLVGTNGIWGQRAADIAGRLGAKVHELLKPPGEYFTLRDIQEGLAQHKPSLLFITHG
ESSTGVLQPLEGLGELCHRQGCLLLVDAVASLGGAPILMDQQGIDVLYTGSQKVLSAPPG
SSPISFSERAREKMLRRKTKPPSFYLDMGCLASYWGCDGEPRMYHHTVPISSIFCLREAL
AMLVELGLESSWKQHRAACTRLYQGLRDLGLELFVKEEAARLPTVTTVRVPEGYNWKDIT
TFLMDKHNIEISGGLGPTAGKVLRIGLMGHNATQDNVDLLLQALRDALQHCQHSRL
NT seq 1251 nt   +upstreamnt  +downstreamnt
atgcaccgcgccgcagcgctgccgatatccatagcagctctcctgcgggcttgcagcaca
gctggccgtgccatggccgcttccacacctttcctccccccaccccgtgagctgctgcgg
ccgctggccgtgccctaccggctgctgctggggccggggcccagcaacgtgtcaccccga
gtgcgggcggccggtggccagcagatcctgggccacatgcaccccgaggtgctgcaggcg
atggatgagatcaaggcgggcatccagtacgccttccagacgcggaaccggctcacattg
gccatcagcggcaccgggcactgcgccatggaggctgccctcctcaacctgctggagggc
agcgacaccgtgctggtgggcaccaacggcatctggggacagcgcgctgctgacatcgcc
gggaggctgggagccaaggtccatgagctgctgaagcctccgggcgagtacttcaccctg
agggacattcaggagggcctggcacagcacaaaccctcactgctcttcatcacccacggc
gagtcctccacgggggtcctgcagccactggaggggctgggcgagctgtgtcaccggcaa
ggctgcctgctgcttgtggatgcggtggcatcgctcgggggagcgcccatcctcatggac
cagcaggggattgatgtactgtacacggggtcccagaaagtcctcagtgccccccctggc
agctctcccatctcattcagtgagcgagcaagggagaagatgctgaggaggaagacgaag
cccccatccttctacctggacatgggctgtctggcaagctactggggctgcgatggcgag
ccacgcatgtaccaccacacggtgcccatcagcagcatcttctgcctgcgggaggccttg
gccatgctggtggagctgggcctggagagctcgtggaagcagcaccgggctgcctgcacc
cgcctgtaccaggggctgcgggacctggggctggagctctttgtgaaggaggaggcagcg
cggctgcccaccgtcaccaccgtcagggtgcctgaaggctacaactggaaggacatcaca
accttcctgatggataaacacaacattgagatctctgggggcctgggccccactgcaggc
aaggtgctgcggatcggcctcatgggccacaacgcgacccaggacaacgtggacctcctg
ctgcaggccctgcgagacgccctgcagcactgccagcacagcaggctgtga

DBGET integrated database retrieval system