KEGG   Gallus gallus (chicken): 770471
Entry
770471            CDS       T01006                                 

Gene name
HOXC10
Definition
(RefSeq) homeobox protein Hox-C10
  KO
K17444  homrobox protein Hox-C10
Organism
gga  Gallus gallus (chicken)
Brite
KEGG Orthology (KO) [BR:gga00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:gga03000]
    770471 (HOXC10)
Transcription factors [BR:gga03000]
 Eukaryotic type
  Helix-turn-helix
   Homeo domain only, AbdB
    770471 (HOXC10)
SSDB
Motif
Pfam: Homeodomain Homeobox_KN
Other DBs
NCBI-GeneID: 770471
NCBI-ProteinID: NP_001292189
CGNC: 13664
Ensembl: ENSGALG00000029393
UniProt: A0A1D5PP81
Position
33
AA seq 354 aa
MSCPNNVTSNSFLMDSLAGTCRGENYSSSQGMYMQPGSDFSCGVMRNCGIIPSLSKRDEV
NSATLSLSTYPSYLSQLDTWCDPKNTYRIEQPVARQLPSCSFPTNVKEENVCCMYNADKR
AKNATEAALYPNQMPEPCLNDHEVPVPSYYRASQGYPSMEKTSNCSNPNEFEASFESRAS
LNPRNEHLEPAPPPPPPPPPPPPVAKVSFPENTKTDNTQNTSTNEIKTEKSAPAPKISPS
EAEKELNKNTDTSTDNSDNEAKEDIKAENTTGNWLTAKSGRKKRCPYTKHQTLELEKEFL
FNMYLTRERRLEISKSINLTDRQVKIWFQNRRMKLKKMNRENRIRELTSNFNFT
NT seq 1065 nt   +upstreamnt  +downstreamnt
atgtcatgtcccaacaatgtgacttctaactcgtttttgatggactcgttggccggtacc
tgtagaggggagaattattcctccagccaagggatgtacatgcagcctgggagcgatttc
agctgcggagtcatgaggaactgtggaattatcccgtctctttccaaaagggacgaggtg
aatagcgctaccttgtctctcagcacctatccatcttacctttctcagctagacacttgg
tgtgaccccaaaaatacgtacaggatcgagcaacctgttgcaagacagctcccatcctgc
tccttcccaaccaatgtcaaggaagagaatgtttgctgtatgtataacgctgacaaaagg
gctaaaaatgccacagaggcagccctctaccccaaccaaatgcctgagccttgcctaaat
gaccatgaagtccccgttcctagctactaccgagcaagccaaggttacccctccatggag
aagacgtcaaactgcagcaatccaaatgagtttgaggcaagttttgaatccagggcgagc
ctgaacccaaggaacgagcatctggaaccagcaccaccacctcctcctcctcctcctcct
ccgcccccggtggctaaagtgagtttccccgaaaacacaaaaacagataatactcagaac
acatccacgaacgaaattaaaacagaaaaaagcgccccagcacccaaaatcagcccttcg
gaagcagagaaagagctgaataaaaacactgacaccagcactgacaattctgacaatgaa
gcaaaagaggatataaaggcagaaaacactacaggaaattggctgacagcaaagagcgga
agaaagaaaaggtgtccttacaccaagcaccagacgctggagctggagaaggaattcttg
ttcaatatgtacttgacccgtgagcgccgcctggagattagtaagagcattaacctgaca
gacagacaagtcaaaatctggtttcagaaccgcaggatgaaactcaagaaaatgaacaga
gagaaccgaatccgcgaactgacgtccaattttaatttcacctga

DBGET integrated database retrieval system