KEGG   Gallus gallus (chicken): 770560Help
Entry
770560            CDS       T01006                                 

Gene name
ZNF703
Definition
(RefSeq) zinc finger protein 703
Organism
gga  Gallus gallus (chicken)
SSDB OrthologParalogGFIT
Motif
Pfam: nlz1 zf-C2H2 zf_ZIC zf-C2H2_4 zf-C2H2_jaz
Motif
Other DBs
NCBI-GeneID: 770560
NCBI-ProteinID: XP_015152915
CGNC: 28749
Ensembl: ENSGALG00000034229
Position
22
AA seq 532 aa AA seqDB search
MSGAPGGPRPRTPPSRGAAGAPSPRPPPADPLRQASRLPIRVLKMLSAHSGHLLHPEYLQ
PLSSTPVSPIELDAKKSPLALLAQTCSQIGKPDPPPSSKLNAVASAGLPAADKEPSARPA
ALKPPGGSGDAPPEDKSSFKPYSKGGEPRKEGPDKAGFRVPSAACPPFPPHSAASPGGSR
GASPQHAEPKGADDKKEPEAGKPGPDGASGALGRGAAAEPGAHGEPPASGRKSEPPALPP
AAGHVAPVSPYKPGHSVFPLPPSSIGYHGSIVGAYAGYPSQFVPGLDPSKAGLVGSQLPG
ALGLPGKPPSSSPLTGASPPSFMQGLCRDPYCLSYHSASHLGSGNCSSCVHDAGSLKSGY
PLVYPAHPLHSVHTTLSSGGTPSLPGHPLYTYGFMLQNDPLPHICNWVSASGPCDKRFAT
SEELLTHLRTHTALPGAEKLLAGYPTSGLGSAASCHLHLPPAAPGSPSTLPASLSLRSPH
TLGLNRYHPYGKSHLPAAGALPVPSLPAAGPYYSPYALYGQRLTSASALGYQ
NT seq 1599 nt NT seq  +upstreamnt  +downstreamnt
atgagcggtgcccccggcgggccccggccgaggaccccgccgagccgcggagccgcgggc
gccccgtcgccccggccgccccccgccgacccgctgcgccaggccagccggctgcccatc
cgcgtcctgaagatgctcagcgcccacagcggccacctcctgcaccccgagtacctccag
ccgctctcctccacgcccgtcagccccatcgagctggacgccaagaagagccctctggcg
ctgctggcccagacctgctcgcagatcggcaaacccgaccctccgccctcctccaagctg
aacgccgtcgcctccgccgggctgcccgccgccgacaaggagccctccgcccgccccgcc
gcgctcaaaccgccgggcggcagcggggacgctccgcccgaggacaagtccagcttcaag
ccctactccaagggcggggagccgcgcaaggagggcccggacaaggccggcttccgcgtg
cccagcgccgcctgcccgccgttccccccgcacagcgccgcatccccgggcggctcccgc
ggcgcgtccccgcagcacgccgagcccaagggcgccgacgacaagaaggagcccgaggcg
ggcaaacccggccccgacggggcgagcggggctttggggcgcggggcggcggcggagccc
ggggcgcacggcgaaccccccgcctcgggccgcaaatcggagccccccgcgctgccgccc
gccgccggccatgtggcccccgtgtctccctacaagccgggccactccgtcttcccgctg
ccgccttccagcatcggttaccacggctccatcgtgggcgcctacgccgggtacccctcg
cagttcgtgcccggcttggaccccagcaaagcggggctggtgggcagccagctgcccggg
gcgctggggctgccggggaagccgcccagttccagcccgctgaccggggcctcgccgccc
tccttcatgcagggattatgccgggacccgtactgcctgagctaccacagcgcctcgcac
ctgggctccggcaactgctccagctgcgtgcacgacgccggcagcctgaagagcggatac
cccctggtgtacccagcgcaccccctgcactcggtgcacaccacgctctcctccggcggc
acccccagcctgcccggccaccccctctacacctatggcttcatgctgcagaacgacccc
ctgccccacatatgcaactgggtgtctgccagcggaccctgcgataagaggtttgccacc
tcggaggagctgctcacccacctacggacccacacggcgctgccgggcgcagagaaactc
ttggccgggtaccccacgtcggggttgggctcggccgcctcctgccacctccacctcccg
cccgccgcccccggcagccccagcacgttaccggcctccctgtccttgaggagcccacac
actttgggactcaacaggtaccacccgtacggcaagagccatttgcccgcagccggagct
ctccccgtgccgtccttgccggctgccggaccttactactccccctacgctctctatggc
caaagactgacttcagcttctgcactgggatatcagtaa

DBGET integrated database retrieval system