KEGG   Gallus gallus (chicken): 770740
Entry
770740            CDS       T01006                                 

Gene name
ARHGAP27
Definition
(RefSeq) rho GTPase-activating protein 27 isoform X1
  KO
K20636  Rho GTPase-activating protein 12/27
Organism
gga  Gallus gallus (chicken)
Brite
KEGG Orthology (KO) [BR:gga00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:gga04131]
    770740 (ARHGAP27)
Membrane trafficking [BR:gga04131]
 Others
  Rho GTPase associated proteins
   Rho GTPase-activating proteins
    770740 (ARHGAP27)
SSDB
Motif
Pfam: RhoGAP WW PH PH_9
Other DBs
NCBI-GeneID: 770740
NCBI-ProteinID: XP_024999769
CGNC: 56248
Position
27
AA seq 846 aa
MRTPTPTLNPTPHHAEGIHAPIGSAPHSAHPHRLGIRQWGFSCCASQVLLWGCAALWGCA
ALWGCAVGLCCAVGLCCAMGQSGGFLLSPCIPHLPHALLGWWHCPDGINPYGISQPLSQP
RPHTHSPSARPTALPRRQFRIWGALLFRPITPTGSARRAQGHSGATRRPDPIALPIALPI
AQHPRCSHWDIPTLRIPSGHPNPADPIGASRPHSAGMLQRSRSRAWQPLQRGEERREPED
PSAHIYLNLQELQREVAARSAAPQPHSPPHSPPHSAHWETHRDTESGHLFYYNPSTGETT
WDCPFQRGEDAVSPGASPPAWGHRDDSTALPYGSVTGEGLWDPHCVGDGPRDEETGMMPY
SPMERRPPTPEADYPELSPDELEVYPEEDCSPPGSYQWGAAPYAPPRRHQELTVSPRWYG
PPGDHEQFGTETVLAGGLHQRASSSSSQDSGLFPWPGGTPVSPGLREEKLKSLDKAGVLN
RTKTMDRGKRIRKNWSSSWTVLEGGILTFFKDSKHSSAGALRHPTTLTTPEHTVELRGAA
IAWASKEKSSKKNVLELRTREGSEFLIQHDSEQIVSTWQRAIADSIAQMGSDVPTEEDAE
SGTEFGSREKLGAPNAADGDSSKVRNKLRKFLQRRPTLQSLRERGYIKDQVFGCSLQALC
EREHGTVPHFVQQCIHSVERRGLDIDGLYRVSGNLATIQKLRYKVDHEEHLDLDDGRWED
VHVITGALKLFFRELPEPLVPFGHFDKFIAAIKMQDPLRKGRCIRDLVRSLPPANHDTMK
VLFRHLCRVIEFKEENRMSVQSIAIVFGPTLLRAPSEEGSMAVHMVFQNQVVELILNQYG
HIFPDG
NT seq 2541 nt   +upstreamnt  +downstreamnt
atgcggaccccaaccccaaccctaaacccaaccccacaccacgcagagggcattcacgca
cccataggctcagccccacactcagcccatccccatcgcctcgggatccgccagtggggt
ttttcctgttgtgcatcccaggtactgctgtggggctgtgctgcgctgtggggctgtgct
gcgctgtggggctgtgctgtggggctgtgctgcgctgtggggctgtgctgcgctatgggg
cagagcggtgggtttttgctgtccccgtgcattcctcaccttccccacgcgctgttgggg
tggtggcactgcccggatgggataaacccttatgggatttcccagccactttcccagcca
cggccccacactcacagcccctccgcccgccccacagccctccccaggaggcaattccgc
atatggggagcgctgctcttccgccccataacaccaacaggaagcgcacgacgcgctcag
ggccacagtggggccacccggcgccccgaccccatagcgctccccatagcgctccccata
gcgcagcatccccgctgttcccattgggacatcccaaccctacggatcccatcgggacat
cccaaccctgcggatcccattggagcatcccgaccccacagtgccgggatgctgcagcga
tcccgcagccgtgcgtggcagccgctgcagcggggcgaggagcgccgggagccggaggac
ccctcggcccacatctacctcaacctgcaggagctgcagcgggaggtcgcagcgcgcagc
gcagccccgcagccccacagcccgccccacagcccgccccacagcgcccactgggagacc
caccgcgacacggagtcgggacatttgttctattacaatcccagcaccggggagacgacg
tgggactgccccttccagaggggggaggacgcagtgagtcccggcgcgtcccccccggcc
tgggggcaccgcgacgacagcacggcgctgccctatgggtcggtgacgggtgaggggctg
tgggacccccactgcgtgggagacggcccccgggatgaggagacggggatgatgccctac
agccccatggagcgcaggccgcccacccccgaggcagattaccccgagctgtccccggat
gagctggaggtgtaccccgaggaggactgctcacccccgggctcctaccagtggggggca
gcgccctacgcacccccccggcggcaccaggagctcacggtgtccccacggtggtacgga
ccccccggcgaccacgagcagttcggcactgagacggtcctggcaggtgggctccaccag
cgggccagcagcagctccagccaggacagcgggttgttcccatggcccggtggcaccccg
gtatcaccagggctccgcgaggagaagctcaaaagcctcgacaaggctggagtgctcaac
aggaccaaaacgatggacagagggaagcggatacggaaaaactggagctcatcctggacg
gtgctggagggcggaatcctgaccttcttcaaggactccaagcactcatctgcgggtgct
ttgcggcaccccaccaccctgaccaccccggagcacacggtggagctgcgcggggccgcc
atcgcctgggccagcaaggagaaatccagcaagaagaacgtgctggagctgaggacgcgg
gagggctccgagttcctcatccagcacgactcggagcagatcgtgtccacgtggcagcgg
gccatcgccgacagcatcgcgcagatgggctccgatgtccccaccgaggaggacgccgag
agcgggacggagttcggctcgcgggagaagttgggcgcgcccaacgcggccgacggcgac
tccagcaaagtgcgcaacaaactccgcaagttcctccagcggcggccgacgctgcagtcg
ctgcgcgagcgcggatacatcaaagatcaggtttttgggtgctcgctgcaagcgctgtgc
gagagggagcacggcaccgtgccgcacttcgtccagcagtgcatccacagcgtggagagg
agagggttggacatagatgggctctaccgcgtcagcggcaacctggccaccatccagaag
ctgcgctacaaagtggaccacgaggagcacctggacctggacgacgggcgctgggaggac
gtccacgtcatcaccggtgccctaaagctgttcttccgagaactgccggagccgctcgtc
cccttcggacactttgacaaattcattgctgccatcaagatgcaggacccgctgcggaag
gggcgctgtatccgtgacctcgtgcgctcactgccgcccgccaaccacgacaccatgaag
gtcctcttcaggcacctctgcagggtgattgagttcaaggaggagaaccgtatgtcggtg
cagagcatcgccatcgtcttcggccccacactgctgcgggcaccgagcgaggagggcagc
atggccgtgcacatggtgttccagaaccaggtggtggagctcatcctcaaccagtatgga
cacatcttccccgacgggtag

DBGET integrated database retrieval system