KEGG   Gallus gallus (chicken): 770753
Entry
770753            CDS       T01006                                 

Gene name
CALHM2
Definition
(RefSeq) calcium homeostasis modulator protein 2
  KO
K19739  calcium homeostasis modulator protein 2
Organism
gga  Gallus gallus (chicken)
Brite
KEGG Orthology (KO) [BR:gga00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:gga02000]
    770753 (CALHM2)
Transporters [BR:gga02000]
 Other transporters
  Pores ion channels [TC:1]
   770753 (CALHM2)
SSDB
Motif
Pfam: Ca_hom_mod DUF996
Other DBs
NCBI-GeneID: 770753
NCBI-ProteinID: XP_015144221
CGNC: 6265
Ensembl: ENSGALG00000008270
UniProt: E1C257
Position
6
AA seq 319 aa
MAALIAENFRFLSLFFKSKDVMIFNGLVALGTVGSEELFSVVAFHCPCSPARNYIYGLAA
IGVPALALFLIGVILNNHTWNVVAECHKRGTKNFSTAATFLLFGSIMGRAAVAPVTWSVI
SLLRGEAYICALSEFVRPSTLDKFPSEFGAEVLARFPCKDVPANLTKFRDEVTRRLRYES
QLFGWLLIGIVAVLVFLTKCLKHCCSPLSYRQEAYWAQYRSNEDKLFRRTAEVHSRILAA
KNVKQFFGFVALDKEEKELVQEFPVEGVQPSPQWNAITGVYIYRENKGFPLYSRLHKWAK
GVEGNGPTPEGHEMLFLAS
NT seq 960 nt   +upstreamnt  +downstreamnt
atggctgcccttatcgctgaaaacttccgcttcctctccttgttcttcaagagcaaagat
gtgatgatctttaatggcctggtggccctgggtacagtgggcagcgaggagctcttctca
gtggttgccttccactgcccctgctccccagcccgtaactacatctatgggctggctgcc
atcggtgtcccagccctggcactattcctcatcggcgtcatcttgaacaaccacacctgg
aacgtagtggctgagtgccacaagcgtggcaccaagaacttctccactgctgccaccttc
ctcctcttcggctccatcatgggccgggcggccgtggcacctgtcacctggtcagtcatc
tccttgctgcgtggggaggcttacatctgtgccctcagcgagtttgtcaggccatccacc
ctggacaagttcccatcagagttcggggctgaggtgctggcgaggttcccctgcaaagac
gtgccggcaaacctcaccaagttcagggatgaggtgacacggaggctgagatacgaatcc
cagctctttggctggctgctcattgggatcgttgccgtcctggtttttctcaccaagtgc
ctgaagcactgctgctcaccactgagctaccggcaggaggcctactgggcccagtaccgc
tccaatgaggacaagcttttccgccgcacggctgaagtccactccaggatcctggcagca
aagaacgtgaagcaattctttggatttgtggcgcttgacaaggaggagaaggagctggtg
caggagttcccagtggagggcgtccagccaagcccccagtggaacgccatcacgggtgtc
tacatctaccgggagaacaagggcttccccctctacagccggctccacaaatgggcaaaa
ggggtggaagggaatgggccaaccccagagggccatgaaatgctcttcttggcttcctaa

DBGET integrated database retrieval system