KEGG   Gallus gallus (chicken): 770828Help
Entry
770828            CDS       T01006                                 

Gene name
ECHS1
Definition
(RefSeq) enoyl-CoA hydratase, mitochondrial precursor
  KO
K07511  enoyl-CoA hydratase [EC:4.2.1.17]
Organism
gga  Gallus gallus (chicken)
Pathway
gga00062  Fatty acid elongation
gga00071  Fatty acid degradation
gga00280  Valine, leucine and isoleucine degradation
gga00310  Lysine degradation
gga00380  Tryptophan metabolism
gga00410  beta-Alanine metabolism
gga00640  Propanoate metabolism
gga00650  Butanoate metabolism
gga01100  Metabolic pathways
gga01200  Carbon metabolism
gga01212  Fatty acid metabolism
Module
gga_M00032  Lysine degradation, lysine => saccharopine => acetoacetyl-CoA
gga_M00085  Fatty acid biosynthesis, elongation, mitochondria
gga_M00087  beta-Oxidation
Brite
KEGG Orthology (KO) [BR:gga00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    770828 (ECHS1)
   00650 Butanoate metabolism
    770828 (ECHS1)
  Lipid metabolism
   00062 Fatty acid elongation
    770828 (ECHS1)
   00071 Fatty acid degradation
    770828 (ECHS1)
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    770828 (ECHS1)
   00310 Lysine degradation
    770828 (ECHS1)
   00380 Tryptophan metabolism
    770828 (ECHS1)
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    770828 (ECHS1)
Enzymes [BR:gga01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     770828 (ECHS1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: ECH_1 ECH_2
Motif
Other DBs
NCBI-GeneID: 770828
NCBI-ProteinID: NP_001264324
CGNC: 56301
Ensembl: ENSGALG00000024271
UniProt: F1NR44
Position
6
AA seq 301 aa AA seqDB search
MAASLRALLRPSAGACADAARRRAFLAALRPLVAGRGCSDGPPFRFLQVQKAGAGGSVGL
IRLQRPEALNALCAGLMEELRRALDAFEADGQVGAIVITGSEKAFAAGADIKEMQNKTFQ
ECYAGGFLAGWDRVATVRKPTIAAVNGFALGGGCELAMMCDIIYAGEKAQFGQPEILLGT
IPGAGGTQRLTRAVGKSLAMEMVLTGERISAAEAKAAGLVSKVFPVDKLLDAAIGCAEKI
AANSKLVVAMAKESVNAAFETTLTEGNRTEKRLFYATFATDDRKEGMTAFVEKRKANFTD
S
NT seq 906 nt NT seq  +upstreamnt  +downstreamnt
atggcggcctcgttgcgcgccctcctccgtcccagcgccggtgcctgcgccgatgccgcg
cggcgccgcgcgttcctggcggcactccgcccccttgtggcggggcgggggtgcagcgac
ggtcccccgttccgcttcctccaggtgcagaaggccggggcgggcggcagcgtggggctg
atccggctgcagcggcccgaggcgctcaacgcgctctgtgcggggctgatggaggagctg
agacgcgcactggacgccttcgaggccgacgggcaggtgggagctattgtcatcaccggc
agtgagaaggcctttgcagccggcgctgacattaaagagatgcagaacaaaaccttccag
gagtgctatgctggcggcttcctggccggctgggaccgggtggccactgtccgcaagccc
accatcgccgctgttaatggcttcgctttgggcggcggctgtgaactggccatgatgtgc
gacatcatctatgccggggagaaggcgcagtttggacagcccgagatcctgctggggaca
atcccaggtgccggcgggacgcagaggctgaccagggcggtgggcaagtcgctggccatg
gagatggtgctgaccggggagcggatctcggcggcggaggccaaagcggcaggtctggtc
agcaaagtcttccccgtggacaagctgctggacgcggccattggctgcgctgagaagatc
gctgccaactccaagctggtggtagctatggccaaggagtccgtcaatgctgctttcgaa
acaacactgacagaggggaacaggacggagaagcgcctcttctatgccacttttgccacc
gacgaccgcaaggaagggatgactgcgtttgtggagaagcgcaaggccaacttcactgac
agttga

DBGET integrated database retrieval system