KEGG   Gallus gallus (chicken): 770863
Entry
770863            CDS       T01006                                 

Gene name
GPC3
Definition
(RefSeq) glypican-3 isoform X3
  KO
K08109  glypican 3
Organism
gga  Gallus gallus (chicken)
Brite
KEGG Orthology (KO) [BR:gga00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   00535 Proteoglycans [BR:gga00535]
    770863 (GPC3)
   00537 Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:gga00537]
    770863 (GPC3)
Proteoglycans [BR:gga00535]
 Cell surface proteoglycans
  Glypican family (GPI-anchored HSPG)
   770863 (GPC3)
Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:gga00537]
 Others
  770863 (GPC3)
SSDB
Motif
Pfam: Glypican
Other DBs
NCBI-GeneID: 770863
NCBI-ProteinID: XP_015134145
CGNC: 4565
Position
4
AA seq 471 aa
MSGSGGASPPSVLFLLLLAAPGFAQPAGEAACRPVRAAFQVLQPGAKWVPESPVPGLDLQ
VCVPKGSTCCSRRMEEKYQAVARQNMEQLLQSASMELKFLVIQNAAVFQEAFEIVVRHAR
NFTNSMFRSHYKSMGPRALKFVGELFTDVSLYILGSDISVNDMINEFFDSLFPLVYSHLI
NPGFPDPSVEMTECLRAARRDLKAFGNYPKMMMTQVSKSLQATRVFLQALNLGIEVINTT
DHLKLSKECGRALLKMWYCSHCQGLLLAKPCAGYCGAVTYGCLAGVGEIDRHWRDYISSL
EGLTKGMRGVYDMEHVLLNLFSLVRDAVIYVQKNGGKLSATVSRLCGHAQQRQYRSTNYP
EDLFIDKKGLKVTHIEQEETLSSRRRELITKLKSHSDFYSTLPEYICNHSSAVQNDTVCW
NGQEVVERYSPHIPRNGAKAQPGNHEGKMKGPEPVISQIIDKLKHINQGTN
NT seq 1416 nt   +upstreamnt  +downstreamnt
atgtcggggagcggcggagcgtcgccgccgtcggtgctgtttctgctgctcctggcggcc
ccggggttcgcccaaccggcgggggaggccgcctgccgcccggtccgagccgctttccag
gtgctgcagcccggagccaagtgggtgcccgagagccccgtgccagggttggacctgcag
gtatgcgtccccaagggctccacgtgctgctcgaggaggatggaggagaagtaccaggca
gtggcccggcagaacatggagcagctcctgcagtctgccagcatggagctgaagttcctt
gtcatccagaatgctgctgtcttccaagaagcctttgagattgtagtgcggcacgcgagg
aacttcaccaacagcatgtttaggagccactacaagagcatggggcccagagctcttaag
tttgttggagaacttttcacggatgtctcgctgtacatactgggctctgacatcagcgtt
aatgacatgataaatgaattttttgatagtttatttcctttggtctactcccacttgatc
aatcccggcttcccggatccctcagtggaaatgactgaatgcctgcgggcagccaggaga
gacctcaaggcctttggtaactacccgaagatgatgatgacgcaggtgtccaagtcgctg
caggccacgcgggtctttctgcaggcactcaacctggggatcgaggtgataaacaccacc
gaccacctgaagctcagcaaggagtgcgggcgggcgctgctcaagatgtggtactgctca
cactgccaggggctgctgctggccaagccctgtgctgggtactgcggtgcggtgacgtac
gggtgcctggcaggggttggtgagatcgaccgtcactggagagattatatcagctccttg
gaggggttgaccaagggtatgcgtggtgtctatgacatggagcacgtcctcctgaacctc
ttctccctggtgagggatgccgtcatctacgtgcagaagaatggaggaaagctctcggca
actgtcagcaggctctgcggtcacgctcagcagaggcagtatcgatccactaattacccc
gaagacctcttcattgacaaaaaaggcctgaaggtgactcacatagagcaggaagaaacg
ctgtcgagcaggaggagggaactgattacgaagctgaagtctcacagtgatttttacagc
accttgccagagtacatctgcaaccacagctctgctgttcagaatgacaccgtttgctgg
aacgggcaagaagtcgtggagaggtacagtccccacatcccaaggaatggagcaaaagct
cagcctggtaaccatgaagggaagatgaaaggtcctgagccagtgatcagccagatcatt
gacaagctgaaacacatcaaccagggcaccaactga

DBGET integrated database retrieval system