KEGG   Gallus gallus (chicken): 770922
Entry
770922            CDS       T01006                                 

Gene name
DGUOK
Definition
(RefSeq) deoxyguanosine kinase
  KO
K00893  deoxycitidine kinase [EC:2.7.1.74]
Organism
gga  Gallus gallus (chicken)
Pathway
gga00230  Purine metabolism
gga00240  Pyrimidine metabolism
gga01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:gga00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    770922 (DGUOK)
   00240 Pyrimidine metabolism
    770922 (DGUOK)
Enzymes [BR:gga01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.74  deoxycytidine kinase
     770922 (DGUOK)
SSDB
Motif
Pfam: dNK AAA_18 AAA_33 Thymidylate_kin AAA_28 AAA_17 AAA_16
Other DBs
NCBI-GeneID: 770922
NCBI-ProteinID: NP_001072968
CGNC: 56373
Ensembl: ENSGALG00000005961
UniProt: Q5ZJM7
Position
13
AA seq 265 aa
MSAPAKRRCRGPAADLDSSFQKRLRKISIEGNIAAGKSTLVRLLEKHSDEWEVIPEPIAK
WCNIQTSEDECKELSTSQKSGGNLLQMLYDKPTRWAYTFQTYACLSRVRAQLKPISAKLH
EAEHPVQFFERSVYSDRYVFASNLFESGNINETEWAIYQDWHSWLLNQFQSEIELDGIIY
LRTTPQKCMERLQKRGRKEEEGIDLEYLENLHYKHETWLYEKTMRVDFENLKEIPILVLD
VNEDFKNDKIKQEYLIDEIKSFLTS
NT seq 798 nt   +upstreamnt  +downstreamnt
atgtccgctcccgccaagaggcgctgccgcggccccgccgccgacctggactccagcttc
cagaagcgcctcaggaagatctccatcgagggcaatatcgcagctggaaagtctacgctt
gtcaggctgctcgagaagcacagcgatgagtgggaggtgatccctgagcccatcgccaag
tggtgcaacatccagaccagtgaggatgagtgcaaggaactttcaacatctcagaagagt
ggaggaaacctacttcaaatgctgtatgataaacctacaagatgggcttatacttttcag
acctacgcctgcttgagccgagtaagggcacagctgaaacccatctcagccaagctgcat
gaagcagaacatccagtgcaattttttgagagatctgtgtacagtgacaggtatgtgttt
gcttctaacctgtttgaatctggaaacatcaatgaaacagagtgggctatctatcaggac
tggcactcatggcttttaaatcagtttcaatctgaaatagaactggatggcatcatctac
ctaaggaccacacctcagaaatgcatggaaagactacagaagaggggaagaaaagaggag
gaaggaattgacctcgagtatttggaaaacctccactataaacatgagacctggctttat
gaaaaaactatgagagttgattttgagaaccttaaagagattcccattctagttttggat
gttaatgaagattttaaaaatgataaaattaaacaggagtacctgattgatgagatcaaa
tctttcctgacttcttaa

DBGET integrated database retrieval system