KEGG   Gallus gallus (chicken): 771145Help
Entry
771145            CDS       T01006                                 

Gene name
MAPK13
Definition
(RefSeq) mitogen-activated protein kinase 13 isoform X1
  KO
K04441  p38 MAP kinase [EC:2.7.11.24]
Organism
gga  Gallus gallus (chicken)
Pathway
gga04010  MAPK signaling pathway
gga04068  FoxO signaling pathway
gga04218  Cellular senescence
gga04261  Adrenergic signaling in cardiomyocytes
gga04370  VEGF signaling pathway
gga04620  Toll-like receptor signaling pathway
gga04621  NOD-like receptor signaling pathway
gga04622  RIG-I-like receptor signaling pathway
gga04625  C-type lectin receptor signaling pathway
gga04912  GnRH signaling pathway
gga04914  Progesterone-mediated oocyte maturation
gga04933  AGE-RAGE signaling pathway in diabetic complications
gga05132  Salmonella infection
gga05164  Influenza A
Module
gga_M00689  MAPK (p38) signaling
Brite
KEGG Orthology (KO) [BR:gga00001]
 Environmental Information Processing
  Signal transduction
   04010 MAPK signaling pathway
    771145 (MAPK13)
   04370 VEGF signaling pathway
    771145 (MAPK13)
   04068 FoxO signaling pathway
    771145 (MAPK13)
 Cellular Processes
  Cell growth and death
   04218 Cellular senescence
    771145 (MAPK13)
 Organismal Systems
  Immune system
   04620 Toll-like receptor signaling pathway
    771145 (MAPK13)
   04621 NOD-like receptor signaling pathway
    771145 (MAPK13)
   04622 RIG-I-like receptor signaling pathway
    771145 (MAPK13)
   04625 C-type lectin receptor signaling pathway
    771145 (MAPK13)
  Endocrine system
   04912 GnRH signaling pathway
    771145 (MAPK13)
   04914 Progesterone-mediated oocyte maturation
    771145 (MAPK13)
  Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    771145 (MAPK13)
 Human Diseases
  Endocrine and metabolic diseases
   04933 AGE-RAGE signaling pathway in diabetic complications
    771145 (MAPK13)
  Infectious diseases
   05132 Salmonella infection
    771145 (MAPK13)
   05164 Influenza A
    771145 (MAPK13)
Enzymes [BR:gga01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     771145 (MAPK13)
Protein kinases [BR:gga01001]
 Serine/threonine kinases: CMGC group
  MAPK family [OT]
   771145 (MAPK13)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr APH Kdo Kinase-like Haspin_kinase
Motif
Other DBs
NCBI-GeneID: 771145
NCBI-ProteinID: XP_001234443
CGNC: 536
Ensembl: ENSGALG00000030966
Position
26
AA seq 365 aa AA seqDB search
MNFTRRRGFYRQELNRTIWELPRRYTSLHPVGSGAYGSVCSAIDKKTGEKVAIKKLCRPF
QSEIFAKRAYRELTLLKQMQHENVIGLLDVFTSAPSYHGFQDFYLVMPYMRTDLQKIMGH
EFSDEKIQYLVYQMLKGLKYIHSAGIIHRDLKPGNLAVNEDCQLKILDFGLARHADAEMT
GYVVTRWYRAPEVILNWMHYNQTVDIWSIGCIMAEMLTGKTLFKGKDYVDQLTQILKVTG
HPGDDFVEKLEDKAAKSYIKSLPKMPKKDLSVLFPTANPQAVDLLDKMLQLDVEKRLTAT
EALAHPYFDQFRDIEEETEAQQSYDDSLEREKLSIEEWKKHIYKEILSFSPIAQKDSKKR
SGMSL
NT seq 1098 nt NT seq  +upstreamnt  +downstreamnt
atgaacttcacaaggagaagaggcttttacagacaggagctgaacagaaccatctgggag
ctgcccaggaggtacacctccctgcaccccgtgggctctggggcctacggttccgtctgc
tccgccatagacaagaagacaggagagaaagtggccatcaagaagctgtgccgcccattc
cagtcggagatctttgccaagagagcgtacagagagctcacgctcttgaagcaaatgcag
catgagaatgtcattgggctgcttgatgtcttcacctccgccccttcctaccacggattc
caggacttctacctggtgatgccatacatgcggacagatttacaaaagatcatgggacat
gaattcagtgatgaaaagatccagtacctggtctaccagatgctgaaagggctgaagtat
attcattctgccggaatcatccacagggacctgaagccaggcaacctggctgtgaatgaa
gactgccagctaaagatcttggactttggcttggcaagacatgctgatgctgaaatgaca
ggctatgtggtcacgcgctggtatagagctccagaagtcattctgaactggatgcattac
aaccagacagtggatatctggtctattggttgcatcatggcagaaatgctgactggaaaa
acgctgtttaaaggaaaagactacgttgatcagctgactcagatcctgaaagtaacaggg
catcccggagatgactttgtggagaagcttgaggacaaggcggctaaaagttatatcaag
tctcttccaaaaatgcccaagaaggatttgtctgtgctcttccccacagccaatcctcag
gcagtggacctgctggacaagatgctgcagctggatgtggagaagcgccttacggccaca
gaagcattagcccacccatactttgatcaattccgagacattgaggaggagacagaggca
caacagtcctacgatgattctctggagcgtgaaaagctttcaatagaagaatggaaaaaa
catatctacaaggagatcttatccttcagtccaattgcacagaaggactcaaagaagcga
agtggaatgtcgctgtag

DBGET integrated database retrieval system