KEGG   Gallus gallus (chicken): 771230
Entry
771230            CDS       T01006                                 

Gene name
ERN2
Definition
(RefSeq) serine/threonine-protein kinase/endoribonuclease IRE2 precursor
  KO
K08852  serine/threonine-protein kinase/endoribonuclease IRE1 [EC:2.7.11.1 3.1.26.-]
Organism
gga  Gallus gallus (chicken)
Pathway
gga04140  Autophagy - animal
gga04141  Protein processing in endoplasmic reticulum
gga04210  Apoptosis
Brite
KEGG Orthology (KO) [BR:gga00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    771230 (ERN2)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    771230 (ERN2)
  09143 Cell growth and death
   04210 Apoptosis
    771230 (ERN2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:gga01001]
    771230 (ERN2)
Enzymes [BR:gga01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     771230 (ERN2)
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.26  Endoribonucleases producing 5'-phosphomonoesters
    3.1.26.-  
     771230 (ERN2)
Protein kinases [BR:gga01001]
 Serine/threonine kinases: Other
  IRE family
   771230 (ERN2)
SSDB
Motif
Pfam: Pkinase Ribonuc_2-5A PK_Tyr_Ser-Thr PQQ_2 PQQ Pkinase_fungal Kdo APH LapA_dom
Other DBs
NCBI-GeneID: 771230
NCBI-ProteinID: NP_001272430
CGNC: 56617
Ensembl: ENSGALG00000027592
Position
14
AA seq 956 aa
MGGPAALLPALLLFLAPLLAPPAQCLKDSAVTVPETLLFISTLDGNLHAVSKSTGDVRWT
LKDDPILQVPVYVAEPAFLPDPNDGSLYILGGKKKEGLMKLPFTIPELVQSSPCRSSDGV
LYTGKKQDTWFIVDPKSGEKQTTLSTEAWDGVCPSSPLLYIGRTQYVITMYDTKTRELRW
NATYSDYSAPLYEESYPYKMSHFASSGDGLVVTLDKESGEVLWAQNYGSPVVGIYVWHQD
SLRRIPHLNLAMETLRYLTFHSQDIHLARWGHQSMKDFTATKTQLLPALYVGKHAASFYA
LTSLVHGSVALVPQGITLARIDGPTTDDVTMRESGECEITPSTDVKYPQGSITALHNQWL
LIGHHELPPVVHTTMLRAFPENLRKATETIIPRSSPARSVFDDFLAPSSAEELALRGSEG
HVPPEPGHREQTEVYPDSGDWDLLLAAVGTALLGGGVLLLLIMKLQKQHEVQQQQLEKQI
QLLQQQRQEMLLPHRSSGEGILAAPEQPVGSRGSAPGQEPGSGPAAPTELVNGTVSMKPA
VSAEAEPDVVVVGKVSFNPKDVLGHGAGGTFVFRGQFEGRNVAVKRLLPECFHLVDREVR
LLQESDEHPHVVRYFCTEKDRQFHYIAIELCSATLQEYVESPSFDRHSLDPVSVLHQTMS
GLAHLHSLNIVHRDLKPCNILISVPNSHGQIRAVISDFGLCKKLQGGRHSFSLRSGIPGT
EGWIAPEVLQEAPKENPTCAVDIFSAGCVFYYVVSGGQHPFGDSLRRQANILAGACQLPC
LEEDVHDKIVAKELITSMLSSEPQKRPSAPAVLMHPFFWNAEKQLHFFQDVSDRVEKEPA
EGALVAALEAGSRAVVRTNWRMHISLPLQMDLRKFRTYKGSSVRDLLRAMRNKKHHYHEL
PAEVREALGSVPDGFVQYFTSRFPRLLLHTHSAMQLCAHERLFRPYYSPELGGTGR
NT seq 2871 nt   +upstreamnt  +downstreamnt
atgggcggccccgccgcgctgctccccgcgctgctgctgttcctcgcgccgctcctcgcg
ccgcccgcacagtgcctcaaagatagcgctgtgactgtcccagaaactctgcttttcata
tccacgctggatggaaacctccacgcagtcagtaagagcactggagacgtcaggtggacc
ctgaaggacgatcccattctgcaggtgccggtctacgtcgcagaaccagcgtttctgcca
gaccctaacgatggcagcctatacatcctgggagggaagaaaaaagaaggcttgatgaag
ctgccgttcaccatcccggagctggtccagtcgtcaccatgccgcagctcggacggggtg
ctctacacggggaagaagcaggacacctggttcattgtggaccccaagtcaggggagaag
cagaccacgctctcaacagaggcctgggatggggtgtgcccctccagcccactgctctac
atcggccgcacccagtacgtcatcaccatgtatgacaccaagacgagggagctgcgctgg
aacgccacctactctgactactcggcaccgctctacgaggagtcctacccctacaaaatg
tctcactttgcctccagcggggatgggctggtggtgacactggacaaggagagcggagag
gtgctgtgggcacagaactatggctcacccgtggtcggcatctacgtgtggcaccaggac
agcctgcggcgcatcccccacctcaacctggccatggagacgctgcgctacctgaccttc
cactcgcaggacatccacctcgcccgctggggccaccagagcatgaaggacttcacggcc
accaagacccagctgctgccagcgctgtacgtggggaagcacgcagccagcttttatgcc
ctgacctccctggtgcacggcagcgtggcgctggtgccgcagggcatcacactggccagg
atcgatggccccaccacagatgacgtgaccatgagagagtcgggagagtgtgagatcacc
cccagcaccgatgtcaagtacccacagggcagcatcaccgcactgcacaaccagtggctg
ctgatagggcaccatgagctgcctcctgtggtgcacaccaccatgctcagagccttccct
gagaacctgaggaaggcgacagaaaccatcattcctcgcagctctcctgccaggagtgtg
tttgatgatttcctggcccccagcagtgcggaggagctggctctgcggggcagcgagggg
cacgtcccacctgagcctggccacagggagcaaacagaggtgtacccggattctggcgac
tgggacctgctgctggctgctgttggcacagcgctgctgggcggtggggtcctgctgctc
ctcatcatgaagctgcagaagcagcacgaggtgcagcagcagcagctggagaaacagatt
cagctcttgcagcagcaacggcaggagatgctgctcccacatcgcagctccggtgagggc
atccttgcagcacccgagcagccagtggggagcagaggaagtgcacctgggcaggagcca
ggctctggtcctgctgcccccacggagctggtgaatgggacggtgagcatgaagccagca
gtgtctgcagaagcggagcctgacgtggttgtcgttgggaaagtttcctttaaccccaag
gatgtgctgggccacggagcaggagggaccttcgtcttcagggggcagtttgaaggccgg
aacgtggctgtgaagcgccttctgcctgagtgcttccacctcgtggaccgggaggtgcgg
ctgctgcaggagtcagacgagcacccccacgtcgtgcgctacttctgcaccgagaaggac
aggcagttccactacatcgccatcgagctctgctccgccacgctgcaggagtacgtggag
agccctagcttcgatcggcacagcctggacccggtgtctgtcctgcaccagaccatgtcg
gggctggcacacctgcactcgctcaacattgttcatcgcgacctgaagccctgcaacatc
ctcatctccgtccccaacagccatggacagatccgagccgtcatctctgactttgggctg
tgcaagaagctgcagggcgggcggcacagcttcagtctgcgctctggcatccctggcacc
gagggctggatcgcacccgaggtgctgcaggaggcaccgaaggagaaccccacctgcgct
gtggacatcttctctgccggctgcgttttctactacgtggtgtcgggaggacagcacccc
tttggggacagcctgcggcgccaggccaacatcctggcaggtgcctgccagctgccctgc
ctggaggaggatgtgcatgacaagatcgtggccaaggagctgatcacgtctatgctcagc
agtgaaccccagaagcgcccctcagcgcctgctgtcctcatgcatcccttcttctggaac
gcagagaagcagctgcatttcttccaggatgtcagtgaccgcgtggagaaggagccggcc
gagggggccctggtggcagcgttggaggcaggcagccgtgccgtggtgaggacaaactgg
aggatgcacatctccctgccgctgcagatggacctgcgcaagttccgcacctacaagggc
agctcagtgcgcgacctgctgcgcgccatgaggaacaagaagcaccactaccacgagctg
cccgctgaggtccgtgaggcgctgggctccgtccccgacggcttcgtgcagtacttcacc
tcccgcttcccccggctgctgctgcacacacacagtgccatgcagctctgcgcccacgag
cggctcttccgcccctactacagccctgagctggggggcacagggaggtga

DBGET integrated database retrieval system