KEGG   Gallus gallus (chicken): 771246
Entry
771246            CDS       T01006                                 

Gene name
HOXD10
Definition
(RefSeq) homeobox protein Hox-D10
  KO
K09295  homrobox protein Hox-D10
Organism
gga  Gallus gallus (chicken)
Brite
KEGG Orthology (KO) [BR:gga00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:gga03000]
    771246 (HOXD10)
Transcription factors [BR:gga03000]
 Eukaryotic type
  Helix-turn-helix
   Homeo domain only, AbdB
    771246 (HOXD10)
SSDB
Motif
Pfam: Homeodomain Homeobox_KN
Other DBs
NCBI-GeneID: 771246
NCBI-ProteinID: XP_001234539
CGNC: 56632
Ensembl: ENSGALG00000009270
UniProt: E1BRT6
Position
7
AA seq 339 aa
MSFPNSSPAANTFLVDSLISACRSDSFYSNSASMYMPPSTDIGTYGMQTCGLLPSLAKRE
VNHQNMGMNVHPYIPQVDSWTDPNRSCRIEQPVTQQVPTCSFTTNIKEESNCCMYSDKRT
KLISSDVPSYQRLVSESCPIENPEVPVPGYFRLSQTYATGKTQEYNNSPETSSTVMLQLN
PRGSSKPQLSSQLQMEKKMNENPNGQDGAAKVSQVESPEPKSTLQDERSCLPEGSVSSPE
VQEKETKEEIKSDTPTSNWLTAKSGRKKRCPYTKHQTLELEKEFLFNMYLTRERRLEISK
SVNLTDRQVKIWFQNRRMKLKKMSRENRIRELTANLTFS
NT seq 1020 nt   +upstreamnt  +downstreamnt
atgtcctttcccaacagctctcctgccgctaatacttttttagtagattctctcatcagt
gcgtgcaggagtgacagtttctactccaacagcgccagcatgtatatgccacctagcaca
gacattgggacttatgggatgcaaacctgtggactcctaccgtctctggctaaaagagaa
gttaatcaccaaaatatgggtatgaatgtacatccttatatacctcaagtagacagttgg
acagatccgaacagatcttgtcgaatagagcaacctgttacacagcaggtccccacttgt
tccttcactacaaatattaaggaagaaagcaattgctgcatgtattccgataagagaacc
aaactcatttcttcagacgtcccttcctaccagaggctggtgtctgaatcatgccccatt
gagaaccccgaggttcccgtcccaggatattttagactgagccagacctacgccactggg
aaaacccaagagtacaataatagccctgaaacgagttcaaccgtaatgttacagttaaac
cctcgcggcagctccaaaccgcagctatcttctcaacttcagatggaaaagaaaatgaat
gaaaacccgaacggccaggacggcgcggctaaagtctctcaagtggaaagtcccgagccc
aagtccacgttgcaagacgagaggagctgcctgcccgaaggctccgtgtccagccccgag
gtccaggagaaggagactaaagaggaaatcaagtctgatactccaacgagcaattggcta
actgcaaagagtggcagaaagaagaggtgcccttacactaaacaccaaacactggaatta
gagaaagagttcttattcaatatgtatctcacccgagagcgccgcctagagatcagtaag
agcgtaaacctcactgacaggcaggtcaagatttggtttcaaaaccgcagaatgaagctc
aagaagatgagcagggagaaccgaatccgagaactgaccgctaatctgaccttctcctaa

DBGET integrated database retrieval system