KEGG   Gallus gallus (chicken): 771273
Entry
771273            CDS       T01006                                 

Gene name
MRPS36
Definition
(RefSeq) 28S ribosomal protein S36, mitochondrial
  KO
K17414  small subunit ribosomal protein S36
Organism
gga  Gallus gallus (chicken)
Brite
KEGG Orthology (KO) [BR:gga00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:gga03011]
    771273 (MRPS36)
Ribosome [BR:gga03011]
 Ribosomal proteins
  Mitochondria/ Chloroplast
   Small subunit
    771273 (MRPS36)
SSDB
Motif
Pfam: S36_mt
Other DBs
NCBI-GeneID: 771273
NCBI-ProteinID: XP_001234565
CGNC: 10968
Ensembl: ENSGALG00000014789
UniProt: F1N8U1
Position
Z
AA seq 107 aa
MGSKMAAATRVVQVVKPHTPLIKFPDRKSGPRPKIQESLQASVPSPHASNAQESVGGRPP
AFQNISPVSRAHGAPDTSELARILPQKYRRKLVSVEEIEYIQRGGPE
NT seq 324 nt   +upstreamnt  +downstreamnt
atgggcagcaagatggcggcggccactcgggtcgtgcaggtagtgaagcctcatactccg
ctgattaagtttccggacagaaaaagcggtcccagacctaaaatacaggaatctctacaa
gcaagtgttccgtcacctcatgcttcaaatgcacaggagtctgtaggagggagaccaccg
gccttccaaaatatttcacctgttagtagggcacatggtgcaccagacacttcggaatta
gcaagaatcttacctcaaaaatacagaaggaaacttgtgtcagttgaagagattgaatat
attcaacgtggaggtccagaataa

DBGET integrated database retrieval system