KEGG   Gallus gallus (chicken): 771327Help
Entry
771327            CDS       T01006                                 

Gene name
TIA1
Definition
(RefSeq) nucleolysin TIAR
  KO
K13201  nucleolysin TIA-1/TIAR
Organism
gga  Gallus gallus (chicken)
Brite
KEGG Orthology (KO) [BR:gga00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:gga03019]
    771327 (TIA1)
   03041 Spliceosome [BR:gga03041]
    771327 (TIA1)
Messenger RNA biogenesis [BR:gga03019]
 Eukaryotic Type
  mRNA surveillance and transport factors
   mRNA cycle factors
    Stress granule specific factors
     771327 (TIA1)
Spliceosome [BR:gga03041]
 Other splicing related proteins
  Spliceosome associated proteins (SAPs)
   RNA binding proteins (RBPs)
    771327 (TIA1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: RRM_1 RRM_occluded RRM_7 Nup35_RRM_2 Calcipressin RRM_3 Nup35_RRM XOO_2897-deam
Motif
Other DBs
NCBI-GeneID: 771327
NCBI-ProteinID: NP_001244132
CGNC: 56693
Ensembl: ENSGALG00000009427 ENSGALG00000013879
UniProt: Q800W4
Position
22
AA seq 372 aa AA seqDB search
MEDEMPKTLYVGNLSRDVTEALILQLFSQIGPCKNCKMIMDTAGNDPYCFVEFYEHRHAA
SALAAMNGRKIMGKEVKVNWATTPSSQKKDTSNHFHVFVGDLSPEITTEDIKAAFAPFGR
ISDARVVKDMATGKSKGYGFVSFFNKWDAENAIQQMGGQWLGGRQIRTNWATRKPPAPKS
TYESNTKQLSYDDVVNQSSPSNCTVYCGGVTSGLTEQLMRQTFSPFGQIMEIRVFPDKGY
SFVRFNSHESAAHAIVSVNGTTIEGHVVKCYWGKETPDMISPVQQNQIGYPQAYGQWGQW
YGNAQLGQYVPNGWQVPAYGMYGQAWNQQGFNQTQSSAAWMGANYSVQPPQGQNGSVLTN
QAGYRVAGFETQ
NT seq 1119 nt NT seq  +upstreamnt  +downstreamnt
atggaggatgaaatgcccaagaccctatacgtggggaacctatccagagatgtgacggaa
gctctgatcctccagctgttcagccagattggaccatgcaaaaactgcaaaatgataatg
gatacagctggaaatgatccctattgttttgtggagttctatgagcatcgccatgcggct
tcggcactggctgccatgaatggccggaagataatgggtaaggaggtcaaagtgaactgg
gcaacgacccccagcagccagaagaaagacacgagcaaccatttccatgtctttgttgga
gacctcagtcccgaaattacaactgaagatataaaagcagcttttgcgccatttggaaga
atatcagatgcacgggtggttaaggacatggcaacggggaaatctaaaggctatggcttc
gtctccttcttcaataaatgggatgcagagaatgctattcagcagatgggtggacagtgg
ctcggtggaaggcaaatcagaacaaactgggcaacgagaaaacctccagctccaaagagt
acatacgaatcaaacaccaaacaactgtcttacgatgacgtggtcaatcagtccagtccc
agcaactgcaccgtgtactgcggaggtgtcacttcaggcctgacagagcagttaatgcgc
cagaccttttctccattcggacagataatggaaatccgagtcttcccagataaaggctac
tcctttgtacggtttaattctcatgagagcgctgcgcatgcgatcgtttctgtcaacggg
acaactatagaaggccatgtggtgaagtgctactgggggaaggagacacctgacatgatc
agcccggtgcagcagaatcaaattggatatcctcaggcttacgggcagtgggggcagtgg
tatggaaatgctcagctcgggcagtacgtgcccaacgggtggcaggtccccgcctacggg
atgtacgggcaggcgtggaaccagcagggcttcaatcagacgcagtcatcggcagcgtgg
atgggagcaaactacagcgtgcagccaccacaggggcagaatggcagcgtgttgacaaac
caggccgggtaccgcgtggcaggctttgagacacagtga

DBGET integrated database retrieval system