KEGG   Gallus gallus (chicken): 771364
Entry
771364            CDS       T01006                                 

Gene name
CBY1
Definition
(RefSeq) protein chibby homolog 1
  KO
K23402  protein chibby 1
Organism
gga  Gallus gallus (chicken)
Pathway
gga04310  Wnt signaling pathway
Brite
KEGG Orthology (KO) [BR:gga00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    771364 (CBY1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:gga03036]
    771364 (CBY1)
Chromosome and associated proteins [BR:gga03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Other cilium assembly proteins
    771364 (CBY1)
SSDB
Motif
Pfam: Chibby Taxilin LapA_dom
Other DBs
NCBI-GeneID: 771364
NCBI-ProteinID: NP_001265078
CGNC: 9279
Ensembl: ENSGALG00000012218
UniProt: E1BT07
Position
1
AA seq 126 aa
MPLFGSTFSPKKTPPRKAASLSNLHLLDRSTREVELGLEYGTPTMNLTGQSLKFENGQWV
AEIGSFTGDRREMQRLRKRNQQLEEENNLLRLKVDILLDMLSETTAESHLMEKELEELKS
HTRRRK
NT seq 381 nt   +upstreamnt  +downstreamnt
atgccgctgttcgggagcaccttcagccctaagaagaccccgccgcggaaggccgcctcg
ctgtccaacctgcacttgctggacagatccacccgcgaggtcgagctgggcctggagtat
ggcacccccaccatgaacctcaccgggcagagcctcaagtttgagaacggccagtgggtg
gcagaaataggaagcttcacgggagatcgcagggaaatgcagcgcttgcgcaaacgcaac
cagcagctggaggaggaaaacaatctccttcgtctgaaggtggatattctgctggacatg
ctctctgagaccaccgccgagtcccacctgatggagaaggagctggaggagctgaagagt
cacacccggaggaggaagtga

DBGET integrated database retrieval system