KEGG   Gallus gallus (chicken): 771446
Entry
771446            CDS       T01006                                 

Gene name
TCFL5
Definition
(RefSeq) transcription factor-like 5 protein isoform X1
  KO
K09092  transcription factor-like 5
Organism
gga  Gallus gallus (chicken)
Brite
KEGG Orthology (KO) [BR:gga00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:gga03000]
    771446 (TCFL5)
Transcription factors [BR:gga03000]
 Eukaryotic type
  Basic helix-loop-helix (bHLH)
   Hairy, Hairy/E(SPL)
    771446 (TCFL5)
SSDB
Motif
Pfam: HLH
Other DBs
NCBI-GeneID: 771446
NCBI-ProteinID: XP_001234727
CGNC: 4196
Ensembl: ENSGALG00000045499
UniProt: A0A1L1RRW4
Position
20
AA seq 513 aa
MSGPAPQPGPAGPSPAAAAPGGDASFGEQSLGFTAADLSLVEMTEIEYSQLQHALYAHVE
ARAGEGEAEARAGAAGPPARHDEGCASCGPAGPPAFPGLCQAGATADGGVPGSNPCVGHA
DFQELRMMLLSEVNPPASQADKTPKGGSAEVSGHGLLRAKHGESFAGASKGSVVVEHVAL
APEPRSKSAVRVRLEDRFNSIQTENPRCQEPQESGVTLNNLVTLIRQPSELVGVPPHQHQ
DKCAAVVKNKSTPTTPSPQFTHPLFTMSACSAAGTANSSQAQASGTSCTILESAKHQEIG
IPRTFSFCYHQEMESTKQTVGAMNKALPEEVWIKVGEDTLCKQAINKRSCSRISPMDANI
DRKPLSEIQNMRDSQSTASAQGPWQSAQSHSSVQVQSGTQEGVTQRRERHNRMERDRRRR
IRICCDELNLLVPFCTADTDKATTLQWTTAFLKYIQEKHGDSLKQEFETVFCGKTGRRLK
VPRSDSFVTCPVQENVQHGYGDQVALNCLSVDK
NT seq 1542 nt   +upstreamnt  +downstreamnt
atgtcggggcccgccccgcagcccggccctgccggcccctctccggctgccgccgccccc
gggggggacgcgtccttcggcgagcagagcctcggcttcaccgccgcggacctcagcctg
gtggagatgacggaaatagagtacagccagctgcagcacgcgctgtacgcgcacgtggag
gcgcgggccggtgaaggcgaggcagaagccagggccggcgctgcgggtccccccgcgcgg
cacgacgagggctgcgcctcctgcggccccgccggcccgcccgccttccccggcctctgc
caggcgggagcgaccgccgacggcggcgtgcccggctcgaacccctgcgtgggccacgcg
gacttccaggagctcaggatgatgttgctcagtgaggtcaacccccctgccagccaagca
gacaaaacgcccaagggtggctctgcggaagtctcggggcacggcttattgagggcgaaa
cacggtgagagctttgctggggcgagcaaagggagcgtagtggttgagcatgtggcgctg
gcacccgagcccagatcgaaatctgcagtcagagttcgattggaggacagattcaacagc
atccagacagaaaaccccagatgccaagaaccccaagaatctggagtgactcttaacaac
ttggtaacgttgattcggcagccatcagagctggtcggtgtcccccctcatcagcatcag
gacaagtgtgcagcggtggtgaaaaacaagagcacacccaccacaccttctccacagttc
acacatccactgttcaccatgagtgcgtgttctgctgctggaactgctaattcctcacag
gcccaggcctctggaacatcttgcactattttggaatctgccaaacatcaagagattggg
attcccagaacattctctttctgttaccatcaggaaatggaatccacaaaacaaacagta
ggtgctatgaataaagctttgcctgaggaagtttggattaaagttggagaagacacctta
tgcaagcaagcgataaacaaaagaagttgcagccgaataagcccaatggatgcaaacata
gatcgcaaacctcttagtgaaatacaaaatatgcgagatagccagagtactgcatctgcc
cagggcccctggcagtcagcacagtcacattcaagtgtgcaggtgcagagtggtacgcag
gaaggagttactcagcgaagagaaagacataaccgcatggagagagacagaaggcgcaga
atccggatttgttgtgatgaactaaatcttctggttccgttctgcactgctgatactgat
aaagcaacaaccttacagtggacaacagcatttctgaagtatattcaggaaaagcatggc
gattctctgaaacaggaatttgagactgtgttctgtggcaaaacaggcaggagactgaaa
gtgcccagatcggattcgtttgtaacatgtccagttcaggagaatgtgcagcatggctat
ggagaccaagtagccctgaattgtctaagtgtggataaataa

DBGET integrated database retrieval system