KEGG   Gallus gallus (chicken): 771459Help
Entry
771459            CDS       T01006                                 

Gene name
ARSB
Definition
(RefSeq) arylsulfatase B
  KO
K01135  arylsulfatase B [EC:3.1.6.12]
Organism
gga  Gallus gallus (chicken)
Pathway
gga00531  Glycosaminoglycan degradation
gga01100  Metabolic pathways
gga04142  Lysosome
Module
gga_M00076  Dermatan sulfate degradation
Brite
KEGG Orthology (KO) [BR:gga00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00531 Glycosaminoglycan degradation
    771459 (ARSB)
 09140 Cellular Processes
  09141 Transport and catabolism
   04142 Lysosome
    771459 (ARSB)
Enzymes [BR:gga01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.6  Sulfuric-ester hydrolases
    3.1.6.12  N-acetylgalactosamine-4-sulfatase
     771459 (ARSB)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Sulfatase Sulfatase_C Phosphodiest DUF1501
Motif
Other DBs
NCBI-GeneID: 771459
NCBI-ProteinID: XP_003642960
CGNC: 3271
Ensembl: ENSGALG00000004438
UniProt: F1P099
Position
Z
AA seq 514 aa AA seqDB search
MERLRALWCLLWCLLRPAAARPPPHLVLVLADDLGWGDVGWHGSAIRTPRLDALGAGGVR
LERYYTQPLCTPSRSQLLSGRYQIHTGLQHQIIWPCQPSCLPLDEKLLPELLKDAGYVTH
MVGKWHLGMYRKECLPTRRGFDTYFGYLLGSEDYYSHDHCVLIKAKNVTRCALDFRDGEE
VATGFKNMYSTNLFTERAIDLIANHKTEKPLFLYLAFQSVHEPLEVSAEYMKPYSSIKDV
KRRRYAGMVSLMDEAVGNLTDALKEYGLWNNTVLVFSTDNGGQTMAGGNNWPLRGRKWTL
WEGGVRGVGFVASPLLKQKGVESHELIHISDWLPTLVHLAGGHTNGTKPLDGFDVWKTIS
EGRPSPRVELLHNIDPMFVDDYPCLGIDNRTSLPQINSSPWDNTLFNISVHAAIRHGKWK
LLTGYPGCGHWFPPPSLSSESQIQSYDPPMKRLWLFDIVHDPEEKYELSEKYPHVVKKLL
SRLQYYYKRSVPVFYPDEDPQCDPAATGVWGPWA
NT seq 1545 nt NT seq  +upstreamnt  +downstreamnt
atggagcggctccgcgcgctgtggtgcctgctgtggtgcctgctgcggccggcggcggcg
cggccccccccacacctggtgctggtgctggccgacgacctgggttggggcgacgtgggc
tggcatggctcggccatccggacgccgcggctggacgcgctgggggcgggcggcgtgcgg
ctggagcgctactacacgcagccgctgtgcacgccgtcccgcagccagctcctcagcggc
cgctaccagatccacacgggtttacaacaccaaataatttggccgtgccagcccagctgt
ctaccacttgatgagaaactcctcccagagctgcttaaagatgcaggatatgttactcac
atggtggggaagtggcatttagggatgtataggaaagaatgcctcccaacccgcagagga
tttgatacttactttggttatcttctggggagtgaggattattattctcacgatcactgt
gtgctcatcaaagcaaagaatgtaacacgctgtgctctggacttccgcgatggagaagaa
gttgcaactggatttaagaacatgtactccacgaatttatttacagaaagagctatagac
cttatagccaatcataaaactgagaagcccctctttctctaccttgcttttcagtctgtc
catgaacctcttgaggtttctgcggagtacatgaaaccatattcctccattaaagatgtc
aagaggcgccgttacgcaggaatggtgtctcttatggatgaagctgtaggaaatcttact
gatgctctgaaagaatacggtctttggaacaacactgttcttgttttctctactgataat
ggaggacagactatggcaggtggaaataactggccacttagaggaagaaaatggaccctc
tgggaaggaggagttagaggagtaggctttgttgcaagtccattactgaagcaaaaaggt
gtagaaagtcacgaacttatccatatctctgactggctgccaacactggtgcaccttgct
ggaggacataccaatggcacaaagcctttggatggctttgatgtttggaaaactatcagt
gaaggaagaccttcccccagagtggaactgcttcataacatagatcccatgtttgtggat
gattacccatgtcttggcattgacaacaggacatctttaccacaaatcaattcttctccg
tgggataatacacttttcaatatctccgtgcatgcagcaatccgtcatggaaaatggaag
ttactaactggatacccaggctgcggtcattggttccctccaccatctttgtccagtgag
tcacagattcagtcatatgatccaccaatgaagagactttggctgtttgatattgttcat
gatcctgaagagaaatatgagttgtctgaaaaatatcctcatgtggtgaaaaagctgctc
tcacgtcttcagtattattataaacgttcagtgcctgtattctatcctgatgaggatccc
cagtgtgatccagcagcaactggggtctggggtccttgggcatag

DBGET integrated database retrieval system