KEGG   Gallus gallus (chicken): 771493
Entry
771493            CDS       T01006                                 

Gene name
BTBD11
Definition
(RefSeq) ankyrin repeat and BTB/POZ domain-containing protein BTBD11 isoform X1
  KO
K10483  BTB/POZ domain-containing protein 11
Organism
gga  Gallus gallus (chicken)
Brite
KEGG Orthology (KO) [BR:gga00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:gga04121]
    771493 (BTBD11)
Ubiquitin system [BR:gga04121]
 Ubiquitin ligases (E3)
  Multi subunit Ring-finger type E3
   Cul3 complex
    Adoptor and target recognizing subunit (BTB)
     771493 (BTBD11)
SSDB
Motif
Pfam: BTB Ank_2 Ank_3 Ank Ank_4 Ank_5 BACK
Other DBs
NCBI-GeneID: 771493
NCBI-ProteinID: XP_015143383
CGNC: 9589
UniProt: A0A3Q3AP09
Position
1
AA seq 1062 aa
MMARRGKTAARTLEDLTLDSGYGGAADSVRSSNLSLCCSDSHPAYPYGGSCRPHLTDSMH
SRHNSFDTVNTVLAEDSEVLDCAGQHCSRLLPDLEEVPWSLEEVEALLQPPQPRRDPRAP
GGGGGGGAAGRDAAARLSTLVSRALVRIAREAQRLSLRFAKCTKHEVRSAMEIVLGWTLA
ARCTAAALGALSLYNMSGSGGDRFSRGKSARCGLAFSVGKFYRWMVDSRVALRIHEHAAI
YLTAGTESLFRDIHARVLAGAGPSAPPPPPQPGRTTPAAAAGPAEREKEGAEGPRFTLEA
LEQTVNNDPELWGLLQPYQHLICGKNASGVLCLPDSLNLHKDQQRSNKPGEVQMFSQSEL
RTIEQSLLATRVGSIAELSDLVSRAMHHLQPLNAKQHGNGTPMHQKQGSLYWEPEALYTL
CYFMHCPQMEWENPNVEPSKVTLQTERPFIVLPPLMEWIRVAVAHAGHRRSFSVDSDDVR
QAARLLLPGVDCEPRQLKIDDCFCASRKLDAVATEAKFKQDLGFRMLNCGRTDLVKQAIA
LLGPDGINSMSEQGMTPLMYACVRGDEAMVQMLLDAGADLNAEVVSTAHKYPSVHPETRH
WTALTFAVLHGHIPVVQLLLDAGAKVEGSLEHGEENYSETPLQLAAAAGNFELVSLLLER
GADPMIGTMYRNGISMTPQGDMNSFSQAAAHGHSHPEEHRYRNVFRKLLAQPEKEKSDIL
SLEEILAEGTDLPDSAAAPLCASRNSKAKLKALKEAMYHSAEHGYVDVTIDIRSIGVPWT
LHTWLESLRTSFQQHRRPLIQCLLKEFKSIQEEEYTEELITQGLPLMFEILKASKNEVIS
QQLSVIFTHCYGPYPIPKLVEIKRKQTSRLDPHFLNNKEMSDVTFLVEGRPFYAHRVLLF
TASPRFKALLSSKPSTDSTCIEINYVKYPIFQLVMQYLYYGGAESLLIKNNEIMELLSAA
KFFQLEALQRHCEIICAKSINTENCVDIYNHAKFLGVTELSSYCEGYFLKNMMVLIENEA
FKQLLYDKNGETSGQNVLQDLQRTLATRIQSIHLSSSKGSIV
NT seq 3189 nt   +upstreamnt  +downstreamnt
atgatggcacggcggggtaagacggcggcgcggacgctggaagacctgacgctggactcc
ggctatggtggcgcggcggactcggtgcgctcctccaacttgtcgctgtgctgctcggat
tcgcaccccgcgtacccctatggaggaagctgccggccgcacctaactgactccatgcac
agtcgccacaacagcttcgacaccgtcaacaccgtcctagcggaagactccgaggtgctg
gactgcgcggggcagcactgctcccggctcctgcccgaccttgaggaggtcccctggagc
ctggaggaggtggaggcgctgctgcagccgccgcagccgcgccgggatccgcgggcgccg
ggcggcggcggcggcggcggcgcggcggggcgggatgcggcggcgcggctgtccacgctg
gtgagccgcgcgttggtgcgcatcgcccgcgaggctcagcgcctcagcctgcgcttcgcc
aagtgcaccaagcacgaggtgcgcagcgccatggagatcgtgctgggctggacgctggcc
gcccgctgcacggcggccgccctcggagccctctcgctctacaacatgagcggcagcgga
ggggaccgcttcagccgcggcaagtcggcgcgctgcgggctggccttctccgtcggcaag
ttctaccgctggatggtggacagccgcgtggccctgcgcatccacgagcacgccgccatc
tacctgacggccggcaccgagagcctcttccgcgacatccacgctcgggtgctggccggg
gccgggccctccgcaccgccgccgccgccgcagcccggccgtaccacccccgccgcggcc
gccggcccggccgagagggagaaggagggcgccgaggggccgcgcttcacgctggaggct
ctggagcagacggtcaacaacgaccccgagctgtgggggctgctgcagccctaccagcac
ctcatctgcgggaagaacgccagcggtgttctctgcttgccggacagcttgaaccttcac
aaagaccagcagcggtcaaacaagcctggagaagtgcagatgttcagccagtccgagcta
aggaccatcgagcagtctttgctggctacgcgtgtggggagcattgccgagctcagtgac
ctcgtatcccgagccatgcaccacctccagccactgaatgccaagcagcacgggaatggc
acaccgatgcaccagaagcaggggtcactctactgggagccagaggctttgtacaccctc
tgctacttcatgcactgcccgcagatggagtgggaaaacccaaatgtggagccgtcaaaa
gtcacgctgcagactgagaggccgttcatcgtgctgccgcccctgatggagtggattcgg
gtcgccgtggctcacgcggggcaccgtcgcagcttctcggtggacagtgatgacgtacgg
caggcagccaggctcctgctgcccggagttgactgtgaacctcgacagctaaaaatcgac
gattgtttttgtgcatctcggaagctggatgcagttgccactgaagcgaagttcaagcag
gacctgggcttccggatgctcaactgtggccgaacggatctggttaaacaggccatagcc
ttgctggggccggatgggattaacagcatgagtgaacagggcatgactccactgatgtat
gcttgtgtcaggggtgatgaggctatggtgcagatgctgctagatgctggagcagatctg
aatgctgaggttgtcagtactgctcataaatacccatccgtccaccctgagacccgccat
tggacagctctgacatttgctgtgttgcatggacatattcctgtagttcagttgttgctg
gatgctggagcaaaagtagaaggttccttggagcatggagaggaaaactactctgaaact
cctttacagttggcagcagctgccggaaatttcgaactggtcagtttgctgttggagcga
ggagctgaccccatgataggaacaatgtacaggaatggcatttccatgactccacaaggt
gacatgaactctttcagtcaggctgctgcgcatggacacagccatccagaggaacataga
tacaggaatgtcttccgtaagctacttgctcagccagagaaggagaagagtgatatcctg
tcactggaggagatactggccgaggggacagacttacctgactctgcagcagctccgctt
tgtgccagccgcaacagcaaggccaaactgaaagccctgaaggaggccatgtaccacagt
gctgagcatggatatgtggatgtgaccattgacatacggagtataggtgttccctggaca
ctgcacacatggctggagtccttgcgaacgtccttccagcagcacagacgacccctcatc
cagtgcttgctgaaggaattcaagtctattcaagaggaagagtacacagaagagctcatc
acgcaggggttgcctctgatgtttgagatactaaaagccagcaagaacgaagtgataagt
cagcagctatctgtcattttcactcattgctacggaccctaccctattccaaagcttgtt
gaaattaagcgcaagcagacctctcgcttagatccccattttcttaacaacaaagagatg
tcagatgttacatttctggtggaaggaagaccattttatgcacatagagtgctgctattt
actgcatcaccacggtttaaagcattgctgtctagcaagccctcaactgatagtacttgt
attgagatcaactatgtgaagtaccccatctttcagctggttatgcagtatctttactat
ggaggtgcagagtcactcttgattaaaaataatgaaattatggagcttctttctgctgct
aaatttttccagcttgaagctttacaacgacactgtgagatcatttgtgcaaaaagcatt
aatacagaaaactgcgtggatatttataatcatgccaagtttctcggagtcacagaacta
tcttcctattgcgaaggctactttctaaaaaatatgatggtcctcattgaaaacgaagct
ttcaagcagctgttgtatgacaagaatggagaaacgtctggtcagaatgtactacaggac
ttacagaggacgttggccacaaggattcagtcaattcatttgtcttcttcaaagggctcc
attgtataa

DBGET integrated database retrieval system