KEGG   Gallus gallus (chicken): 771503Help
Entry
771503            CDS       T01006                                 

Gene name
CERS6
Definition
(RefSeq) ceramide synthase 6 isoform X1
  KO
K23727  sphingoid base N-palmitoyltransferase [EC:2.3.1.291]
Organism
gga  Gallus gallus (chicken)
Pathway
gga00600  Sphingolipid metabolism
gga01100  Metabolic pathways
Module
gga_M00094  Ceramide biosynthesis
gga_M00099  Sphingosine biosynthesis
Brite
KEGG Orthology (KO) [BR:gga00001]
 09100 Metabolism
  09103 Lipid metabolism
   00600 Sphingolipid metabolism
    771503 (CERS6)
Enzymes [BR:gga01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.291  sphingoid base N-palmitoyltransferase
     771503 (CERS6)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: TRAM_LAG1_CLN8 Homeodomain
Motif
Other DBs
NCBI-GeneID: 771503
NCBI-ProteinID: XP_025008399
CGNC: 8284
Ensembl: ENSGALG00000010902
Position
7
AA seq 395 aa AA seqDB search
MAGILAWFWNERFWLPHNVTWADLQSTEEASFPQAEDLYLAFPLAFCIFMIRLLFERFIA
KPCALGLKVQANGPQKAQPNAILEKVFTAITKHPDEKRLEGLSKQLDWDVRSIQRWFRQR
RNQEKPSTLTKFCESMWRFTFYLYIFTYGVRFLKKTPWLWNTRQCWNGYPYQPLMPDLHY
YYIAELSFYWSLMFSQFIDIKRKDFGIMFTHHIVTVTLITFSYVTNLTRVGTLTLCLHDA
ADVVLEAAKMANYCKCQKLSDLLFLTFAIVFIVSRLGIYPLWILNTTLFELYEALGNFPA
LWVFNVLLVVLQILHYFWSYLIIKAAYKAISKGKAGKWNPLHVTKDDRSDIESSSDEEET
VPRSKTLHSTITTNGTGGANGTNGYLTGSTCSEEH
NT seq 1188 nt NT seq  +upstreamnt  +downstreamnt
atggcagggatcctcgcctggttctggaacgagcggttctggctgccgcacaacgtcacc
tgggccgacctgcagagcacggaggaagcctctttcccgcaggcggaggacctctacctc
gccttccctctggccttttgcatctttatgatccgcctgctcttcgaaaggttcattgct
aaaccatgtgccttaggccttaaagtccaagccaacggaccacagaaagctcaacctaat
gctatcttggaaaaagttttcacagccattacaaagcatccggatgagaagaggctggag
ggcctctccaagcagctggactgggatgtacgcagcattcagcgttggtttcgacaaaga
cgcaaccaggagaagccaagtactcttacaaagttctgtgagagcatgtggagatttaca
ttttacctttatatatttacctatggagtacggttcctgaaaaagacaccctggctttgg
aataccagacagtgctggaatggttacccatatcagccactgatgcctgaccttcattat
tactacattgctgaattatcattctactggtccttaatgttttctcaattcattgacatc
aaaagaaaggattttggcatcatgtttacacatcacattgtaacagtcaccctgataacc
ttctcatatgtaaccaatttgacacgagtgggaaccctgaccttatgtctccatgatgcg
gctgatgttgtcctagaggctgccaaaatggcaaactattgcaagtgtcaaaaactgagt
gaccttctgttccttacgtttgccattgtcttcattgtcagtaggcttggcatatatcct
ttatggatattaaacactacattgtttgaactgtatgaagctctgggcaattttcctgcc
ttgtgggtcttcaacgtgctgcttgtggttctacaaattctgcactatttttggtcttat
ctaataataaaggcagcctacaaagctatttcaaagggcaaggctggaaagtggaacccc
ttgcatgtaacaaaggatgaccgaagtgatattgagtcaagctcagatgaggaagaaaca
gtacctcgttcaaagaccctgcacagcactatcaccactaatgggactggtggtgccaat
gggacaaacgggtatcttactggtagcacatgctcagaggagcattaa

DBGET integrated database retrieval system