KEGG   Gallus gallus (chicken): 771574Help
Entry
771574            CDS       T01006                                 

Gene name
PLA2G4EL2
Definition
(RefSeq) cytosolic phospholipase A2 epsilon isoform X1
  KO
K16342  cytosolic phospholipase A2 [EC:3.1.1.4]
Organism
gga  Gallus gallus (chicken)
Pathway
gga00564  Glycerophospholipid metabolism
gga00565  Ether lipid metabolism
gga00590  Arachidonic acid metabolism
gga00591  Linoleic acid metabolism
gga00592  alpha-Linolenic acid metabolism
gga01100  Metabolic pathways
gga04010  MAPK signaling pathway
gga04217  Necroptosis
gga04270  Vascular smooth muscle contraction
gga04370  VEGF signaling pathway
gga04912  GnRH signaling pathway
Brite
KEGG Orthology (KO) [BR:gga00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    771574 (PLA2G4EL2)
   00565 Ether lipid metabolism
    771574 (PLA2G4EL2)
   00590 Arachidonic acid metabolism
    771574 (PLA2G4EL2)
   00591 Linoleic acid metabolism
    771574 (PLA2G4EL2)
   00592 alpha-Linolenic acid metabolism
    771574 (PLA2G4EL2)
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    771574 (PLA2G4EL2)
   04370 VEGF signaling pathway
    771574 (PLA2G4EL2)
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    771574 (PLA2G4EL2)
 09150 Organismal Systems
  09152 Endocrine system
   04912 GnRH signaling pathway
    771574 (PLA2G4EL2)
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    771574 (PLA2G4EL2)
Enzymes [BR:gga01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.4  phospholipase A2
     771574 (PLA2G4EL2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PLA2_B cPLA2_C2 C2
Motif
Other DBs
NCBI-GeneID: 771574
NCBI-ProteinID: XP_001234838
CGNC: 56885
UniProt: R4GHN4
Position
5
AA seq 812 aa AA seqDB search
MGSNLSSNETFTGTSAPVERTRPVSPFNLLTVKILRLRNVRKADLLTLSDCYVTLWLPTA
SSEKVRTRTIRNSKNPVWNEAFCYKIDRRVKNVLELKVCDEDTITRDDELCTVLFDIDKL
SVGRTIRVKFQLNPQAREELEVEFTLQNTLDYPDGIITNGVLVAREVSCLEVRVDTGKLK
QQSTNQELTFTVKGSHEGSQKISLGSEPSLQIIVFHCIINDQTRLDIMLPEELADKNQTQ
EYGVLSFPLNSLPLRKEITVEEDQSLQLCLTSRKCSGDLDVRLGYSLCREEQDFLRKRKK
YVAAALKKILNLEEDLKEHEVPVVAITTTGGGTRSLTAMYGSLLGLQKLNLLDCISYIGG
LSGTTWTMANLYEDAGWSEKYLEEAIKEARKQVTKNKICCFSLDCLKYYYNDLMERVKEG
RNTSFIDLWGLVIESMLHDKKDEHRLSDQRQAVDNGQNPLPIYVAINLKSNYSAQAFREW
LEFTPYEVSLLKYGASIRVEHFGSEFFMGRLVKKLPETRICYMQGMWSSIFSIDVMYVWN
LAADSEDFWFRWTRDRVKDIEEEPFLSMNPYEVDTCLLTPSSTFSSVLRDVLTGRPTIAQ
YPNFIRGLQMHSKYLESDGFSTWKDTVIDCFPNKLMETANDELSLVDTGFFINTSYPPLL
RSKREVDVILHLNYSGGSQTLPLDQIAKYISGQGIPFPKIEISDEDRENLKECYVFEDAD
SPQVPTVLFFPLVNDTFKNYKAPGVERSPEELAEGKVDVCSILSPFTTREVCFSEENFDK
LVKLTDYNVLNNEKLIIQALRMAVARRKQRNY
NT seq 2439 nt NT seq  +upstreamnt  +downstreamnt
atgggatcaaatttaagttcaaatgagacttttacgggcacctcagcgccagtggagaga
acgaggccagtatctcctttcaacttacttactgtaaaaatactaagactgaggaacgtc
cggaaggcagacttactcaccctttcagattgctatgtgacgttgtggttgcctactgca
tcgtctgagaaggttcgaaccagaaccatcaggaacagcaaaaatccagtctggaatgaa
gctttctgttacaagattgaccgacgagtgaagaatgtgctggagctgaaggtttgcgat
gaagacacgatcaccagggatgatgaactctgcacagttctctttgacatagataaactc
agtgtaggacgtaccattcgagtgaaatttcaactgaatccgcaggcacgtgaggagctg
gaggtggagttcacattgcagaacactctggactatcctgatggcatcattactaatgga
gtactagtggctcgtgaggtttcctgtttggaggtcagagtggatacagggaagctgaag
cagcaatccacaaatcaggagcttacgttcacagtgaaaggatcccatgaaggaagccag
aagatttccctgggctctgagccgagccttcagatcattgtatttcattgcatcataaat
gaccagacaagactggacatcatgttaccagaagagctggctgacaaaaatcaaactcag
gaatatggagtcctctcttttcctctgaattcactccctttgcggaaggaaataacagta
gaagaggatcaatccttacagttgtgcttgacatcaagaaaatgctcaggagacctggat
gtgcgcctggggtacagcctgtgcagggaggagcaagacttcctgcggaaaaggaagaag
tatgttgctgctgctctgaagaagatccttaatttggaggaggatctgaaggagcatgag
gtgccagtggtggccatcacgacgactgggggcgggacgaggtcactgacagcgatgtat
ggcagcctactggggctccagaaactcaatctgttagactgcatttcttacattggtggt
ttatcgggcaccacatggacaatggcaaacttgtatgaagatgctggctggtcagaaaaa
tatctggaagaggcaatcaaggaagctcgcaagcaagtaaccaaaaacaagatctgctgt
ttttccttggattgtctgaagtactactataatgacttgatggagagggttaaagaagga
cgtaacacatctttcatagacttatggggtcttgtcattgaatccatgctacatgataag
aaagatgaacacagactctcggatcagcggcaggcagtggataatgggcagaacccattg
cccatttatgtggccatcaacctcaagtccaactatagtgctcaggcattcagagagtgg
ttggagttcactccttatgaagtcagtctcctgaaatatggagcatctatccgtgtagaa
cattttggaagtgaattctttatgggaaggcttgtgaagaagctcccagagactcggatc
tgctacatgcaaggcatgtggagtagtatattttccatagatgtgatgtatgtctggaat
ttggctgctgattcagaggatttctggttcagatggaccagagacagagtaaaagatatt
gaggaagaaccctttctgtccatgaatccttatgaggtggacacatgtctgctcactccc
tcatccaccttctcctctgttttgcgagatgtcttaacgggacgcccaaccattgcacag
tatcccaattttatcagaggtttacagatgcacagcaaatacctggagagtgatggattt
tctacctggaaagacacagtgatagactgtttcccaaataaactgatggaaacagctaat
gatgagctctccctggttgatactgggtttttcatcaataccagctacccaccacttttg
agatcgaaaagggaagtggatgtcatcctgcatttaaattacagcggagggtcccagaca
ctgcctctggatcagattgcaaaatatatatcggggcaaggaattccatttcccaaaatt
gagataagtgatgaagacagggaaaacttgaaggaatgttatgtgtttgaagatgctgac
agtccacaagttccaacagtgctctttttccccttagtgaatgacaccttcaagaactac
aaagctcccggtgtggaaaggagtccagaagagctggctgaaggcaaagttgatgtttgc
agtatcctttccccgtttacaacaagggaggtctgtttcagtgaagagaattttgacaaa
ctggtgaagctgactgattacaatgtcctgaataatgaaaagttgattattcaggccttg
cgcatggcagtggcacggaggaagcagagaaattactag

DBGET integrated database retrieval system