KEGG   Gallus gallus (chicken): 771636
Entry
771636            CDS       T01006                                 

Gene name
NKX1-1
Definition
(RefSeq) NK1 transcription factor-related protein 1
  KO
K09309  homeobox protein Nkx-1
Organism
gga  Gallus gallus (chicken)
Brite
KEGG Orthology (KO) [BR:gga00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:gga03000]
    771636 (NKX1-1)
Transcription factors [BR:gga03000]
 Eukaryotic type
  Helix-turn-helix
   Homeo domain only, Antp
    771636 (NKX1-1)
SSDB
Motif
Pfam: Homeodomain Homez
Other DBs
NCBI-GeneID: 771636
NCBI-ProteinID: XP_015141479
CGNC: 56932
Position
4
AA seq 409 aa
MNVSRDKVGDISIPAAAAAAVTAPAAAAGIGGESCGVRGEGMDSHGEQRLSAGGELPLYS
CPGNRDRQGDSQSNTPGQEGAVAALPIVHRTTSFSVLDILDPNKFNSKRRQCAVLYKSVA
TEFTLGAEDKPEDSGTELAEPKALAEDFDTCKKSAELIKDGELYKAEECDLDYSSRPSRS
PDSELQDDEELCSEESSSSGSTGSGSAAPGEAEAGPQHSEAPEAQPPPPQQPGGGQQQAK
PKRKRTGSDSKSGKPRRARTAFTYEQLVALENKFKSTRYLSVCERLNLALSLSLTETQVK
IWFQNRRTKWKKQNPGADTSAPTGGGGAGGGAGGALGGGALPGGLSPLSHSPPMGNPLSM
HGPGSYAGHPAGGLVCAAQLPFLPSPAVLSPFVLGSQTYGAPAFYTPHL
NT seq 1230 nt   +upstreamnt  +downstreamnt
atgaatgtgagcagagacaaggtcggtgacatctccatcccggcagcggcagccgcggcc
gtgacagcccccgcagccgcggcgggcatcggcggggagtcctgcggcgtgcgcggggaa
ggcatggacagccatggggagcagcggctgtcggccggcggagagctgccgctctactcc
tgccctgggaatagggacagacaaggggacagccagagcaacactcccggacaagagggg
gcagtggccgcgctgcccatagtgcacagaaccacctccttctccgtgctcgacatactg
gaccctaacaaattcaacagcaaaaggaggcaatgcgcggtcttgtacaaatcggtggcg
accgagttcacgctgggggcggaggataagcccgaggactcagggacggagctggccgag
ccaaaagctctcgccgaagatttcgacacgtgcaagaagtccgcagagctgatcaaggac
ggcgagctctacaaggccgaggagtgcgacctggactacagcagccggccgagccgcagc
cccgacagcgagctgcaggacgacgaggagctgtgcagcgaggagagcagcagcagcggc
agcaccggcagcggctcggcggctcccggcgaggccgaggcgggcccgcagcactccgag
gctcccgaggcgcagccgccgccgccccagcagcccggcggagggcagcagcaggccaag
cccaagaggaagcgcacgggctcggactccaagtcgggcaaaccccggcgggcgcggaca
gctttcacctacgagcagctggtggcgctggagaacaagttcaagtccacgcggtacctg
tcggtgtgcgagcgcctcaacctggcgctctcgctcagcctcaccgagacgcaggtgaag
atctggttccagaaccgccgcaccaagtggaagaagcagaacccgggcgccgacaccagc
gcgcccaccggcggcggcggggcgggcggcggggcgggcggggcgctgggcggaggggcg
ctgccgggcggcctcagcccgctcagccactcgccgcccatgggcaacccgctgtccatg
cacgggcccggcagctacgcgggtcacccggccggggggttggtgtgcgccgcccagctg
cccttcctgcccagcccagccgtcctctcgcccttcgtgctgggctcgcagacttacggc
gctccggctttctacacccctcacctataa

DBGET integrated database retrieval system