KEGG   Gallus gallus (chicken): 771663
Entry
771663            CDS       T01006                                 

Gene name
TAS2R7
Definition
(RefSeq) taste receptor type 2 member 7
  KO
K08474  taste receptor type 2
Organism
gga  Gallus gallus (chicken)
Brite
KEGG Orthology (KO) [BR:gga00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:gga04030]
    771663 (TAS2R7)
G protein-coupled receptors [BR:gga04030]
 Others
  Chemoreception
   Taste
    771663 (TAS2R7)
SSDB
Motif
Pfam: TAS2R
Other DBs
NCBI-GeneID: 771663
NCBI-ProteinID: NP_001074188
CGNC: 56955
Ensembl: ENSGALG00000010334
UniProt: Q2AB81
Position
3
AA seq 321 aa
MAEQHNTTSSSSAFVVIFAFQALAGMGINAFIVAASCMAWFKKKGMNSNEKILLFLGCFR
FWYLCATWIYLIISVLFPQNLLDTGISLTFAIFMCFLSSSNLWTSTCLYAFYLMKIANFR
HHFFIYLKARIDRIVPWLLLSSVVLSLLNCSPFLKVIDEENRTSPNFTTQGIFWKTNEEI
RKHFNSIISICTCGFSMAFILVTLFAFFLLFSLCRHKHKMQTSSTRSLSMDAHIKAMKSL
LSFFFTFSIHYILLITTVYYSSKENFLVLLLLVLQYSFPVIHSLILIFSNPRLERIALRI
LPCAKCKECARQPTETPMLCS
NT seq 966 nt   +upstreamnt  +downstreamnt
atggcagagcagcacaacacaacttcatccagtagcgccttcgtggtcatcttcgccttc
caggcgctggccggcatggggatcaatgccttcattgtggctgcgtcttgtatggcgtgg
ttcaagaagaagggcatgaactctaacgagaagatcttactgtttctgggctgcttcagg
ttttggtatctgtgcgccacgtggatatacctcatcatttcagtgttgtttccccagaac
cttttagacacaggcatctctctcacttttgcaatttttatgtgctttttaagctcttcc
aacctgtggacttctacctgcctctatgctttttaccttatgaaaattgccaatttcagg
caccatttcttcatctacctgaaagccagaatcgacaggattgtgccgtggctgctgctg
agctccgtggttctgtccctgctcaactgcagccctttcctcaaagttattgatgaagag
aacagaaccagccccaatttcaccacccaagggattttctggaaaacgaacgaagaaata
aggaaacattttaacagcataatttccatctgcacatgtgggttttccatggcattcata
ttggtaaccctctttgccttcttcctcctcttctccctctgcagacacaagcacaagatg
cagaccagctccaccaggagcctcagcatggatgcccacatcaaagccatgaaatccctt
ctgtccttcttcttcaccttcagcattcattacatcttgttgatcacaacagtgtattac
agcagcaaggaaaatttcctggtgttactccttttggtccttcaatactcttttccggtc
attcattcccttattctgatttttagcaaccccagactggaaaggatagcactaaggatt
ctgccctgtgcaaagtgcaaggagtgcgccaggcagcccaccgaaacaccgatgctttgt
tcttaa

DBGET integrated database retrieval system