KEGG   Gallus gallus (chicken): 771771
Entry
771771            CDS       T01006                                 

Gene name
TBC1D13
Definition
(RefSeq) TBC1 domain family member 13
Organism
gga  Gallus gallus (chicken)
SSDB
Motif
Pfam: RabGAP-TBC TFIID_20kDa
Other DBs
NCBI-GeneID: 771771
NCBI-ProteinID: XP_001233464
CGNC: 3439
Ensembl: ENSGALG00000004645
UniProt: A0A1D5PZ78
Position
17
AA seq 399 aa
MSRLHRSRIADFQEVLGEPTVALDKLRDLCFSGIPFDGGLRCLCWKILLNYLPLERALWS
SLLKKQRDLYSQFLKEMIIQPGIAKANLGVSREDVTLEDHPLNPNPDSRWNTYFKDNEVL
LQIDKDVRRLYPDMAFFQRPTDYPCLLILDPQNEFETLRKRVEQTTLKSQTVARNRSGVT
NVSSPLKSSPSSLSEYEVLPNGCEAHWEVVERILFIYAKLNPGIAYVQGMNEIVGPLYYT
FATDPNSEWKEHAEADTFFCFTNLMAEIRDNFIKSLDDSQCGITYKMEKVYSTLKEKDVE
LYLKLQEQNIKPQFFAFRWLTLLLSQEFLLPDVIRIWDSLFADDKRFDFLLLVCCAMLTL
IRDQLLEGDFTLNMRLLQDYPISDVHLILKKAKELQDSK
NT seq 1200 nt   +upstreamnt  +downstreamnt
atgtcgcggttgcaccggagcaggatcgcggatttccaggaggtgctcggcgaacctacg
gtggctctggacaagcttcgcgatctctgcttcagcggaatcccgtttgacggagggctg
cgctgcctctgctggaagatcctgctgaactacctccccttagagagggccctatggagc
tctttgctgaagaagcagagggatctgtattcccagttcctaaaagagatgattattcag
cctgggatcgccaaagccaacctcggcgtctcaagggaagatgtcaccttagaggatcac
cccctcaatccaaacccagacagccggtggaatacttacttcaaagacaacgaggtgctc
ctccagatagacaaagacgtcaggaggctgtaccccgacatggcattcttccagcgcccg
accgactacccctgccttctaatcctggacccccaaaatgagtttgagacgctgcgtaag
cgggtggagcagaccacgctgaagtcccagacggtggcacggaaccgcagcggggttaca
aatgtgagctcccctcttaaatcatctccttcctctctgagtgagtacgaagttctgccc
aatggctgcgaagctcactgggaagtggtggagcgaatccttttcatctatgccaagctg
aaccccgggatagcctacgttcaggggatgaatgaaatagtggggcccctttactacacc
tttgctacagatcctaacagcgagtggaaagaacacgctgaagctgacacttttttctgc
tttaccaacctaatggctgaaattcgggacaacttcattaagagcttggacgattctcag
tgtggtataacctacaaaatggagaaggtctattccaccctgaaggaaaaggatgtggag
ctgtatttgaagctgcaagagcagaacatcaaaccccagttcttcgccttccgctggctg
acactgctcttgtcccaagagttcctgctgccagatgtcatccggatctgggactccctc
tttgctgacgataaacgcttcgatttcctgctgttggtgtgttgtgccatgctgacacta
atccgggatcagttgctggaaggagacttcactctcaacatgaggctgctacaggattat
cccatatctgatgttcacctgattttgaagaaagccaaggaacttcaggattccaaatag

DBGET integrated database retrieval system