KEGG   Gallus gallus (chicken): 771782
Entry
771782            CDS       T01006                                 

Symbol
RAB7B
Name
(RefSeq) ras-related protein Rab-7b
  KO
K07898  Ras-related protein Rab-7B
Organism
gga  Gallus gallus (chicken)
Pathway
gga04137  Mitophagy - animal
gga04140  Autophagy - animal
gga04145  Phagosome
gga05132  Salmonella infection
Brite
KEGG Orthology (KO) [BR:gga00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    771782 (RAB7B)
   04140 Autophagy - animal
    771782 (RAB7B)
   04137 Mitophagy - animal
    771782 (RAB7B)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    771782 (RAB7B)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:gga04131]
    771782 (RAB7B)
  09183 Protein families: signaling and cellular processes
   04031 GTP-binding proteins [BR:gga04031]
    771782 (RAB7B)
Membrane trafficking [BR:gga04131]
 Endosome - Lysosome transport
  Rab GTPases and associated proteins
   Rab GTPases
    771782 (RAB7B)
GTP-binding proteins [BR:gga04031]
 Small (monomeric) G-proteins
  Rab Family
   Rab7/9 [OT]
    771782 (RAB7B)
SSDB
Motif
Pfam: Ras Roc Arf Gtr1_RagA GTP_EFTU MMR_HSR1 RsgA_GTPase SRPRB ATP_bind_1 PduV-EutP cobW AAA_22 MMR_HSR1_Xtn AAA_14 DAP3
Other DBs
NCBI-GeneID: 771782
NCBI-ProteinID: XP_001235016
CGNC: 57042
Ensembl: ENSGALG00000000769
UniProt: F1NVC7
Position
26:complement(2349204..2352291)
AA seq 207 aa
MPQQGPSMDSSKKVDLKIIIIGALGVGKTSLLHQYVHKTFYEDYRTTLGASILTKVVAVD
KTPLKLQIWDTGGQERFRSMVSTFYKGSDGCMLAFDVTDMESFEALDNWRDDFLEKVIPR
DHDFPMVVLGNKIDLCDRQVSKEIASAWCKEKDIPYFEVSAKNNINVAQAFETLAKQALT
TYKGIYESYLTDSIKLTPEDKPTKRCC
NT seq 624 nt   +upstreamnt  +downstreamnt
atgccccaacagggcccatccatggactccagcaaaaaggttgatctgaagattattatc
ataggagctctgggcgtgggcaaaacctccctcctgcaccaatatgtgcacaagaccttt
tatgaagattaccgcaccacgctgggcgccagcatcctgaccaaggtcgtggcagtggac
aaaacccccctgaagctgcagatatgggacacggggggacaggagcgattccggtccatg
gtgtcgaccttctacaagggctctgatggatgcatgctggccttcgatgtgacagacatg
gagtccttcgaggccctggacaactggagagatgatttcctggagaaggtcatcccgagg
gatcacgacttccccatggtcgtgttggggaacaaaatagacctctgtgaccggcaggtg
tccaaagagattgcctctgcctggtgcaaggaaaaagacatcccttacttcgaagtcagc
gccaagaacaacatcaacgtggcacaagccttcgagacgctcgccaagcaagccctgacc
acgtataaagggatttacgagagttatttaaccgactccatcaagctcactcctgaagac
aaacccaccaagagatgctgctga

DBGET integrated database retrieval system