KEGG   Gallus gallus (chicken): 771794
Entry
771794            CDS       T01006                                 

Gene name
DENR
Definition
(RefSeq) density-regulated protein
  KO
K24272  density-regulated protein
Organism
gga  Gallus gallus (chicken)
Brite
KEGG Orthology (KO) [BR:gga00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:gga03019]
    771794 (DENR)
Messenger RNA biogenesis [BR:gga03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   Transport factors
    eIF4F and regulatory proteins
     771794 (DENR)
SSDB
Motif
Pfam: SUI1
Other DBs
NCBI-GeneID: 771794
NCBI-ProteinID: NP_001072973
CGNC: 2776
Ensembl: ENSGALG00000003795
UniProt: Q5ZJ39
Position
15
AA seq 198 aa
MATDVAEPVVPDCRGDIRSGARSDADYPLRVLYCGVCSLPTEYCEYMPDVTKCRQWLEKN
FPDEFAKLTVENSPKQEAGVGEGQGTAGEEEEKKKQKRGGRGQIKQKKKTVPQKVTIAKI
PRAKKKYVTRVCGLATFEIDLKEAQRFFAQKFSCGASVTGEDEIIIQGDFTDDIIDVIQE
KWPEVDDDSIEDLGEVKK
NT seq 597 nt   +upstreamnt  +downstreamnt
atggccacagatgtagctgagcctgtggtccctgactgcaggggagacataaggagcggc
gccaggtcagatgctgactaccctcttcgggtcctctactgcggagtctgttcattgcca
acagagtactgtgaatatatgcctgatgtgactaaatgcagacaatggttagagaagaat
tttccagatgagtttgcaaaacttacagtagaaaattcaccgaaacaggaagctggggtt
ggagaaggccaaggaactgcaggagaagaagaagagaagaagaagcaaaagagaggtgga
agaggtcagataaaacagaaaaagaagactgtaccacagaaagtcacaatagctaaaatt
cctagagcaaagaaaaaatacgtcacaagagtctgcggccttgcaacgttcgaaatcgac
ctcaaggaagcacaaaggttttttgctcagaaattttcctgcggtgcctcagtaacagga
gaagatgaaatcatcattcagggcgatttcacagatgacattattgatgtaatccaggag
aagtggcctgaggtggatgatgatagcattgaagatcttggagaagtcaagaagtga

DBGET integrated database retrieval system