KEGG   Gallus gallus (chicken): 771805
Entry
771805            CDS       T01006                                 

Gene name
RRH
Definition
(RefSeq) visual pigment-like receptor peropsin
  KO
K04253  visual pigment-like receptor peropsin
Organism
gga  Gallus gallus (chicken)
Brite
KEGG Orthology (KO) [BR:gga00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:gga04030]
    771805 (RRH)
G protein-coupled receptors [BR:gga04030]
 Rhodopsin family
  Vision
   Opsin
    771805 (RRH)
SSDB
Motif
Pfam: 7tm_1 7TM_GPCR_Srsx 7TM_GPCR_Srt NOT2_3_5
Other DBs
NCBI-GeneID: 771805
NCBI-ProteinID: NP_001073227
CGNC: 9245
Ensembl: ENSGALG00000012181
UniProt: Q69FK3
Position
4
AA seq 334 aa
MHWNDSANSSESDAEAHSVFTQTEHNIVAAYLITAGVISIFSNIVVLGIFVKYKEFRTAT
NAIIINLAFTDIGVSGIGYPMSAASDLHGSWKFGYTGCQIYAALNIFFGMASIGLLTVVA
VDRYLTICRPDIGRRMTTRNYAALILAAWINAVFWASMPTVGWAGYASDPTGATCTANWR
KNDVPFVSYTMSVIAVNFVVPLTVMFYCYYNVSRTMKQYTSSNCLESINMDWSDQVDVTK
MSVVMIVMFLVAWSPYSIVCLWSSFGDPKKISPAMAIIAPLFAKSSTFYNPCIYVIANKK
FRRAILAMVRCQTRQEITISNALPMTVSLSALTS
NT seq 1005 nt   +upstreamnt  +downstreamnt
atgcattggaatgattcagccaactcctccgaaagtgatgctgaagctcattctgtcttt
acacagactgagcacaacatagtcgcagcttacttaataacagcaggagtgataagcatt
ttcagcaatattgttgtgttaggcatctttgtgaagtacaaagagtttcggacagcaacc
aatgcaattattatcaacctggctttcactgacattggtgttagtggcattggctacccc
atgtctgctgcttcagacctgcatggaagctggaagtttggatatactggatgccagatc
tatgctgccttaaatatattttttgggatggcgagtattggtttgctcactgttgttgca
gttgaccgttacctgacaatctgcaggcctgacataggaagaagaatgactacccgtaac
tatgccgctctaatcctggctgcgtggatcaacgcagtcttttgggcgtccatgcctact
gtaggctgggctggctatgcttcagatccgactggagcaacttgcacagccaattggagg
aaaaatgatgtgccctttgtttcctacacaatgagtgtaattgctgttaattttgttgta
cccttaacagtcatgttttactgttattacaatgtttcccggacaatgaaacaatacacc
agcagtaactgcctggagagcatcaacatggattggtctgaccaagtagatgtaacaaag
atgtctgttgtgatgattgtcatgttcctggtggcatggtctccctattccattgtgtgt
ctatggtcttcctttggagacccgaagaaaatttctcctgcaatggccatcatagctcct
ttatttgcaaaatcctccacgttctataatccctgcatttacgtcattgcaaacaaaaag
tttcggagagcaatcctggcaatggtgcgatgtcagacaagacaagaaataactataagc
aatgccttgcccatgactgtttctctgagtgcattgacgtcataa

DBGET integrated database retrieval system