KEGG   Gallus gallus (chicken): 772164
Entry
772164            CDS       T01006                                 

Gene name
PANX1
Definition
(RefSeq) pannexin-1 isoform X1
  KO
K03443  pannexin 1
Organism
gga  Gallus gallus (chicken)
Pathway
gga04621  NOD-like receptor signaling pathway
Brite
KEGG Orthology (KO) [BR:gga00001]
 09150 Organismal Systems
  09151 Immune system
   04621 NOD-like receptor signaling pathway
    772164 (PANX1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:gga02000]
    772164 (PANX1)
Transporters [BR:gga02000]
 Other transporters
  Pores ion channels [TC:1]
   772164 (PANX1)
SSDB
Motif
Pfam: Innexin
Other DBs
NCBI-GeneID: 772164
NCBI-ProteinID: XP_015135999
CGNC: 12934
Ensembl: ENSGALG00000039751
UniProt: A0A1D5P0I0
Position
1
AA seq 433 aa
MAIAHIATEYVFSDFLLKEPPETRYKGLRLELALDKIVTCIAVGLPLLLISLAFAQEVSI
GAQISCFAPSSFSWRQAAYVDSYCWAAVQQKQPAYNNPENIPLWLHKFFPYILLLVAILL
YLPCLFWRFTAAPHLSSDLKFIMEELDKAYNRAIKAANSVRSGDPRDPADSIPAANENLT
QSLWEISDSHFKYPIVEQYLKTKKNSKCLIIKYIFCRLLTLVIIFIACLYLGYYISLSSL
SDEFLCTIKTGILRNDTTVPEVVQCKLITVGVFKVLSYINLIVYLLVMPLVVYAMFVPFR
WNSGILKVYEILPTFDVLKLKSKSLDDLSIYLLFLEENVSELKSYKCLKVLENIAVSEKF
DVMQLLINLGTIKTDTVDGKPGTAVPGKPEETAVEELEKDATELQVLADRDASGHVSPKE
DKKLRQRLIDSSC
NT seq 1302 nt   +upstreamnt  +downstreamnt
atggccatcgcgcacatcgccaccgagtacgtcttctcggacttcttgctgaaggagccg
cccgagacgcgctacaaagggctgcggctggagctggcgctggataagatcgtcacctgc
atcgccgtggggctgccgctgctcctcatctccctcgctttcgcccaggaggtctccatc
ggtgcccagataagctgctttgcccccagctccttctcctggcgccaggctgcctacgtg
gactcctattgctgggcagcggtgcagcaaaagcagccagcctacaacaacccagagaac
attcccctctggctgcataaattcttcccatacatccttctgctcgtggccatcctgctg
tacctaccatgtctgttctggcgcttcacggcagctcctcacctctcttcggacctgaag
tttatcatggaagaacttgacaaagcctataacagagcaatcaaggctgctaatagcgtc
cgtagcggagaccccagggaccccgctgactccattccagctgctaacgaaaacttgacg
cagagcctgtgggaaatctccgacagccactttaaatacccgattgtggagcagtacttg
aagacaaagaagaattccaaatgcttaatcatcaaatacattttctgccgtttactcact
ctggtgattattttcattgcctgcctctatctgggctactacatcagcctttcctctttg
agcgacgagtttctctgcaccatcaaaacagggatcttaaggaatgacacaaccgttcca
gaagtggtccagtgcaagctgattactgttggtgtcttcaaggtgctcagctacattaac
ctgatagtctatctcctggtgatgccactggtggtatacgcaatgtttgttcccttccgg
tggaattcgggcattctcaaagtgtatgaaatcctgccgacgttcgacgttctgaagctg
aagtccaagagtttagatgacttaagcatttacctcctctttcttgaggaaaacgtgagt
gaactgaaatcatataaatgcctcaaagtgctggagaacattgctgtgtccgagaagttt
gatgtcatgcaacttttgataaaccttggcacaattaagacagatactgttgatgggaag
ccagggacggctgtgccagggaagccggaggagacagctgtagaagagctggagaaggat
gcaacagagctacaagttttggcagaccgtgatgcaagtggccacgtgagcccaaaagaa
gataaaaagcttcgccaaagacttattgactcttcgtgctga

DBGET integrated database retrieval system