KEGG   Gallus gallus (chicken): 776024
Entry
776024            CDS       T01006                                 

Gene name
LHX4
Definition
(RefSeq) LIM/homeobox protein Lhx4 isoform X2
  KO
K09374  LIM homeobox protein 3/4
Organism
gga  Gallus gallus (chicken)
Brite
KEGG Orthology (KO) [BR:gga00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:gga03000]
    776024 (LHX4)
Transcription factors [BR:gga03000]
 Eukaryotic type
  Helix-turn-helix
   Homeo domain with LIM region
    776024 (LHX4)
SSDB
Motif
Pfam: LIM Homeodomain Homeobox_KN Furin-like_2
Other DBs
NCBI-GeneID: 776024
NCBI-ProteinID: XP_015145978
CGNC: 1220
Ensembl: ENSGALG00000036587
Position
8
AA seq 388 aa
MMQSSALAAEGAVKGLPEILGVPVQQIPQCAGCSQHILDKFILKVLDRHWHSSCLKCADC
QMQLAERCFARAGSVYCKEDFFKRFGTKCTACQQGIPPTQVVRKAQDFVYHLHCFACIIC
SRQLATGDEFYLMEDGRLVCKEDYETAKQNDDSEAGAKRPRTTITAKQLETLKNAYKNSP
KPARHVREQLSSETGLDMRVVQVWFQNRRAKEKRLKKDAGRHRWGQFYKSVKRSRGAGKL
EKESSAEDCGVSDSELSFRDDQILSELGHTNRVYGSVGDVAGGQLLNGGFAMDGTGQPYQ
DLRDGSPYGLPQSPSSISSLPSHPPLLNGLDYAMDSSMGLGAQGVSQTLRAMAGGGPTSD
ISTGSSVGYPDFPTSPASWLDDMDHPPF
NT seq 1167 nt   +upstreamnt  +downstreamnt
atgatgcaaagctcagcgctcgctgccgaaggggctgtcaaggggctgccggagatcctc
ggggtgccggtacaacagatcccccagtgcgccggctgcagccagcacatcctggacaag
ttcatcctgaaggtgctggaccgccactggcacagctcgtgcctaaagtgcgccgactgc
cagatgcagctggccgagcgctgcttcgcccgcgccggcagcgtctactgcaaggaggac
ttcttcaagcgcttcgggaccaaatgcacggcgtgccagcagggcatcccccccacgcag
gtggtgcgcaaagcccaggacttcgtctaccacctgcactgcttcgcctgcatcatctgc
agccggcagctggccaccggcgacgagttctacctgatggaggacgggaggctggtgtgc
aaggaggactacgagactgccaagcagaacgatgactccgaggcgggggctaagcggccc
cgcaccaccatcacagccaagcagctggagacgctgaagaatgcctacaagaattccccc
aagcctgcacggcatgtgcgggagcagctctcctccgagacggggctggacatgagagtg
gtgcaggtgtggttccagaaccgtcgggccaaggagaagcggctgaagaaggacgcggga
cggcaccgctggggccagttctacaagagcgtcaaacggagccgcggggccggcaagctg
gagaaggagagctcagctgaagactgcggggtcagcgacagcgagctcagcttccgcgac
gaccagatcctctccgagctcggccacaccaaccgggtttacggcagcgttggcgacgtg
gcaggaggacagttgctgaacggtggcttcgccatggacgggacggggcagccgtaccag
gacttgcgggacggcagcccctacgggctcccccagtcgccgtcgtccatctcttcgctg
ccgtcccacccgcccttgctcaacgggttggactacgccatggacagcagcatggggctg
ggggcgcagggggtgagtcagacgctgcgcgccatggccggggggggccccacctccgac
atctccacggggagcagcgtcgggtacccagactttcccaccagcccggcctcctggctg
gacgacatggatcacccccctttctaa

DBGET integrated database retrieval system