KEGG   Gallus gallus (chicken): 776040
Entry
776040            CDS       T01006                                 

Gene name
CGRRF1
Definition
(RefSeq) cell growth regulator with RING finger domain protein 1 isoform X1
Organism
gga  Gallus gallus (chicken)
SSDB
Motif
Pfam: zf-C3HC4_3 Prok-RING_4
Other DBs
NCBI-GeneID: 776040
NCBI-ProteinID: XP_001235056
CGNC: 9268
Ensembl: ENSGALG00000012206
UniProt: E1BT28
Position
5
AA seq 342 aa
MAAVFLVTLYEYSPLFYITVVFVCFLVTSGLVLGWFGLGVPVILRNSEETESSTRVLKKR
MRQVKNPFGLEISHPDTASVTRGITLIPDCLEDCVLTCYWGCNVQKLHEALQKHVYCFRI
NTPQALEDALYDEYLYRQQYFIKKNDKEEKYCQLPEDAQVVDFGPVPRLCYPLIALLTLA
DEEDREIYDIISMVSVIHVPDESYRLSCRILYQYLLLAQGQYHDLKQLFMSANSTTPPSC
GTSPDERSTDRRLLEKAGLAEDEPELHEENSKDCVVCQNGTVNWVLLPCRHTCLCDGCIK
YFQQCPMCRQFVQESFPLCSKKEQDEDESTQILQDVHPGRVF
NT seq 1029 nt   +upstreamnt  +downstreamnt
atggccgccgtgtttctcgtcacactttacgagtactctccgcttttctacatcacggtg
gtgttcgtctgtttcctcgtcaccagcggcctggtgctgggctggtttggtttgggtgtc
cctgttattctcagaaactcagaagaaacagaatccagcacgagagtactgaagaagcga
atgagacaagtgaagaacccttttggtttagaaatctctcatcctgacacagcttctgta
acaaggggtataacactgatacctgactgtctggaagactgtgttcttacgtgctactgg
ggctgcaatgttcaaaaactccatgaagcgttacaaaaacatgtctactgcttcagaata
aatactcctcaggcattagaggatgctctgtacgacgaatatctctatcgacagcaatac
ttcataaaaaaaaatgacaaggaagaaaaatattgtcagctaccagaagatgctcaagtt
gtcgattttggcccagtgcctagactttgctatccattgatagcgctgctgacattagct
gacgaagaagacagggaaatatatgatattatttcaatggtgtctgtaattcatgttcct
gatgagagctacagactttcctgcagaatattatatcagtatctgcttctagctcaaggc
caataccatgatctgaagcagctcttcatgtctgcaaatagtactacaccaccttcatgt
ggtacctctccagatgagagaagcaccgacagacgcttgctggagaaggctggactggct
gaagatgaaccagaattgcatgaagaaaacagtaaagactgcgttgtatgccagaatggc
acagtgaactgggtactcctaccctgcaggcacacgtgcttgtgtgatggctgcattaag
tattttcagcagtgtccaatgtgtaggcagtttgttcaagagtctttcccactctgcagt
aaaaaggagcaagatgaagatgaatcaacccagatcttgcaagatgttcatcctggaaga
gttttttaa

DBGET integrated database retrieval system