KEGG   Gallus gallus (chicken): 776400Help
Entry
776400            CDS       T01006                                 

Gene name
CCR8L
Definition
(RefSeq) C-C chemokine receptor 8 like
  KO
K04183  C-C chemokine receptor type 8
Organism
gga  Gallus gallus (chicken)
Pathway
gga04060  Cytokine-cytokine receptor interaction
Brite
KEGG Orthology (KO) [BR:gga00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    776400 (CCR8L)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:gga04030]
    776400 (CCR8L)
   04050 Cytokine receptors [BR:gga04050]
    776400 (CCR8L)
   04090 CD molecules [BR:gga04090]
    776400 (CCR8L)
G protein-coupled receptors [BR:gga04030]
 Rhodopsin family
  Chemokine
   CC Chemokine
    776400 (CCR8L)
Cytokine receptors [BR:gga04050]
 Chemokine receptors
  CC Chemokine
   776400 (CCR8L)
CD molecules [BR:gga04090]
 Proteins
  776400 (CCR8L)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 7tm_1 7TM_GPCR_Srsx
Motif
Other DBs
NCBI-GeneID: 776400
NCBI-ProteinID: NP_001074363
CGNC: 57917
Ensembl: ENSGALG00000011734
UniProt: Q702H6
Position
2
AA seq 377 aa AA seqDB search
MEQRKKPTGRHTRALYLWFFPSQESKMNPTDLFLSTTEYDYGYDENTAPCNEGNSFPRFK
SLFLPILYCLVFVFCLLGNSLVLWILLTRKRLMTMTDICLLNLAASDLLFIVPLPFQAYY
ASDQWVFGNALCKIMAGIYYTGFYSSIFFITLMSIDRYIAIVHAVYAMKIRTASCGTMIS
LVLWLVAGLASVPNIVFNQQLEIEQSVQCVPVYPPGNNIWKVTTQFAANILGLLIPFSIL
IHCYAQILRNLRKCKNQNKIKAIKMIFIIVIVFFLFWTPFNVVLFLDSLQSLLIIDNCQA
SSQITLALQLTETISFIHCCLNPVIYAFAGVTFKAHLKRLLQPCARILWSPTRGSGVTQS
SLVLSQISGCSDSAGVL
NT seq 1134 nt NT seq  +upstreamnt  +downstreamnt
atggaacagaggaagaagccaacagggagacatacccgggccctttacctttggttcttt
ccttcacaggaatccaagatgaatcccacagacctgttcctaagcacaacagagtatgac
tatggatatgatgaaaacactgctccttgcaatgaaggaaacagctttcccaggtttaaa
tctctcttcctgccaatcctttactgcctcgtgtttgtcttctgccttctgggaaactcc
ttggtcctctggatcctcctgaccagaaagaggctgatgacgatgactgatatctgcctg
ctgaaccttgcagcctccgatctcctcttcattgtgcctctccctttccaagcatactat
gcttcggatcagtgggtttttggcaatgcattgtgcaagataatggctggcatttattac
acgggtttttacagcagtattttctttataactctgatgagtattgacaggtacatagca
attgtccacgctgtctatgccatgaagatacggacggcctcttgtggcacaatgatcagc
ttagtcctgtggctggtggctggcttggcttctgtacccaacatcgtgttcaaccagcag
ctggaaattgagcagtctgtgcagtgtgtccctgtgtatccccctggcaacaatatctgg
aaggttacaactcagtttgctgccaatatcttgggtctcttgattccctttagcatcctc
atccactgctatgcccagatcctaagaaacttgcgaaaatgcaaaaatcaaaacaagatc
aaagcaatcaagatgattttcatcattgtcattgttttcttcctcttctggacccccttc
aatgtcgtgctcttcttggactccctgcagagcctgcttatcattgacaactgccaggcc
agcagccagatcaccttggccctgcagctcacagaaaccatttccttcatccactgctgc
ctcaaccctgtgatctatgcctttgctggggtgacgttcaaggctcacctgaaaagactg
cttcaaccctgtgcccgtatcctctggagccccaccagaggctctggggtcactcagtca
tctttggtgctcagccagatctctggctgctctgacagcgctggggtgctctga

DBGET integrated database retrieval system