KEGG   Gallus gallus (chicken): 776802
Entry
776802            CDS       T01006                                 
Symbol
CBX5
Name
(RefSeq) chromobox protein homolog 5
  KO
K11587  chromobox protein 5
Organism
gga  Gallus gallus (chicken)
Brite
KEGG Orthology (KO) [BR:gga00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:gga03036]
    776802 (CBX5)
Chromosome and associated proteins [BR:gga03036]
 Eukaryotic type
  Heterochromatin formation proteins
   HP1 (heterochromatin protein 1)
    776802 (CBX5)
SSDB
Motif
Pfam: Chromo_shadow Chromo Mtf2_C
Other DBs
NCBI-GeneID: 776802
NCBI-ProteinID: XP_015155845
CGNC: 58306
Ensembl: ENSGALG00000036856
UniProt: A0A1D5NZ92
Position
33:complement(7718318..7723857)
AA seq 189 aa
MGKKSKRTADSSSSEDEEEYVVEKVLDRRVVKGQVEYLLKWKGFSEEHNTWEPEKNLDCP
ELISEFMKKYKKMKEGDGNKAREKAESGKRKGLPANAEDIKAKKKRESNDIARGFERGLE
PEKIIGATDSCGDLMFLMKWKDTDEADLVLAKEANLKCPQIVIAFYEERLTWHAYPEDTD
SKEREAAKS
NT seq 570 nt   +upstreamnt  +downstreamnt
atgggcaagaaaagcaaaaggacagcagacagttcgtcctctgaagacgaggaggagtat
gtggtggagaaagtgctggaccggcgcgtggtgaaggggcaggtggagtatctgctcaag
tggaaaggcttctctgaggagcacaacacctgggagccagagaagaacctggactgccca
gagcttatctcggagtttatgaaaaagtacaagaagatgaaggagggggatggcaacaaa
gcacgggagaaggcagagagtggcaaaaggaaagggctgcccgccaacgctgaggatatc
aaggccaagaagaagagggagagcaacgacatcgcccggggctttgagcggggcctggag
cccgagaagatcatcggggccaccgactcctgcggagacctcatgttcctcatgaagtgg
aaggacacggatgaggccgacctggtgctggcgaaggaggccaacctgaaatgtccccaa
attgtcattgccttttatgaggagagactgacctggcacgcctaccccgaggacacggac
agcaaagagcgcgaggctgccaagagctaa

DBGET integrated database retrieval system