KEGG   Gallus gallus (chicken): 776856
Entry
776856            CDS       T01006                                 

Gene name
AKAP8L
Definition
(RefSeq) A-kinase anchor protein 8-like
  KO
K15978  A-kinase anchor protein 8-like protein
Organism
gga  Gallus gallus (chicken)
Brite
KEGG Orthology (KO) [BR:gga00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99994 Others
    776856 (AKAP8L)
SSDB
Motif
Pfam: AKAP95
Other DBs
NCBI-GeneID: 776856
NCBI-ProteinID: NP_001186466
CGNC: 10174
Ensembl: ENSGALG00000039974
UniProt: A0A1D5PZG6
Position
30
AA seq 707 aa
MVANVLTVMETGTLGQTEARYESYNYGYGYGQDNSGNYGYGMAASNSWDMGNSDMDMNPD
GAGSADTVIAKMNQRLDMVSHLDADSMQGGHYGSGGDRYDSYESYDSRSSMNDRDVYRSG
YDYNENDNDNAYDSHYDGHYDDHYESHYDSFYGSRRDQYQHRARDGFGQRGQNWARDGRN
TRPMASPYSGRMGGQWNDAPRGMGPHGSSRLPSLFSHNIIPELGMFQGMRGFSGSMRFGG
GMMKQRMRRNWKMWDSDFKPQKKKMKKDLTGKKRKQTSSSDEPDSKAAKTDGSDNSDSDN
EEGTEGESGEKEEKEGSRGEGEDEEGRDSEKGALTIQEEISQIKRKLQAGKKTQERQKKR
HRDRMVERIQYVCSLCKYRTFYDDEMNSHLESKFHKEHFKFVGTKLPQQTADFLQEYVAN
KTRKTEERRKAIEDINAVIQQIYRDQDLTQDIGMEHFIKKVEAAHCAACDLFIPMQYGII
QKHLKSLDHNHNRRAMMEQSKKSSLVVARSILNNKLISKKLERYLKGENPFTDDPEEKEE
HEEGEGGVAGNVEEGTAEGGDENKDEEENLEEENADDENKEENVGDENKEEGNLDNENKG
DEMLDDENKEEGNLRDESNDPKENPEGNENEEEEEKGTERETEAQAEAQEVEPGAGSRGG
EEEEEEEEVWQPAGESLPEDEEQQPAEGEEEEESEETTAAPEDEDVA
NT seq 2124 nt   +upstreamnt  +downstreamnt
atggtggccaacgtgttgaccgttatggagactggaactctgggacaaacagaggcaaga
tatgagagctataattatggctacggctacgggcaggacaactcgggcaactatggctac
ggcatggctgcctccaactcgtgggatatgggcaactcggacatggacatgaacccagat
ggtgctggcagtgccgacaccgtcattgccaaaatgaaccagcgcctggacatggtgtcc
cacctggatgctgacagcatgcagggggggcactacggctccggcggggaccggtacgac
tcatatgaatcctacgactcgaggtcctcgatgaatgaccgggacgtgtaccgctccggt
tacgactacaacgagaacgacaacgacaacgcctacgacagtcactacgacggtcattac
gatgaccactacgaaagtcactacgacagcttctacgggagccgcagggaccagtaccag
cacagggcacgggatggctttggccaacggggtcagaactgggcgcgggacgggcgcaac
accagacccatggcttcaccgtactcggggcgcatgggcgggcagtggaacgacgctccg
cggggcatgggcccccacggctcctcccgcctgccttccctcttctcccacaacatcatc
ccagagctgggcatgttccaaggaatgcgagggttttcggggagcatgcgcttcggtgga
ggcatgatgaagcagaggatgaggagaaactggaaaatgtgggattcggactttaaacct
caaaagaagaaaatgaagaaggacctcacagggaagaagcggaagcaaaccagcagctcg
gatgaacccgacagcaaggcggcaaagactgatggctccgacaactctgactctgacaac
gaggaaggaaccgaaggagaatcgggagaaaaagaggagaaagaaggctccagaggtgaa
ggggaagatgaagaaggacgagactcagagaaaggtgctttaacaattcaagaagagatc
agtcaaatcaaacgcaaattacaggcgggcaagaaaactcaagagaggcaaaagaagagg
caccgggatcgcatggtggaaaggatccaatacgtttgctcgctgtgcaaataccgcacc
ttctacgacgacgagatgaacagtcacctggagagcaaattccacaaggagcacttcaag
tttgttggaaccaagctgccccagcaaacagccgacttcctgcaggaatacgttgccaat
aaaacgaggaaaactgaagagcgccgtaaagcaattgaggacatcaacgcggttatccag
cagatctacagggaccaggatcttacacaagacatcggcatggagcacttcatcaagaag
gtggaggccgctcactgcgctgcatgcgacctcttcatccccatgcaatatggcatcatc
cagaagcacctgaagtcactcgaccacaaccacaaccgcagggccatgatggagcagtcc
aagaagtcatccctggtagtggccaggagcattctgaacaacaagctgatcagtaagaaa
ctggagcggtacctgaagggtgagaatcctttcacggatgaccccgaagaaaaagaggag
cacgaggagggagaagggggagtggctgggaacgtggaggaagggacagcggaaggagga
gacgaaaacaaggacgaggaggagaatctggaagaagagaatgcggacgatgagaacaag
gaggaaaacgtgggcgacgagaacaaggaggaagggaatttagacaatgagaacaaaggg
gacgaaatgttagacgatgaaaacaaagaggaaggaaatctgcgggatgaaagcaacgat
cccaaggagaacccagaaggaaatgaaaatgaggaggaggaagaaaaggggacagagaga
gaaactgaggcccaggcagaagcacaagaggtggagccgggcgcagggagcagagggggg
gaagaggaggaggaggaggaggaggtttggcagcccgcgggggaatcgctgcccgaggac
gaagagcagcagccagcagaaggtgaggaggaggaggagagtgaagaaaccactgctgct
cccgaggatgaggatgtggcataa

DBGET integrated database retrieval system