KEGG   Gallus gallus (chicken): 777133
Entry
777133            CDS       T01006                                 

Gene name
LMX1A
Definition
(RefSeq) LIM homeobox transcription factor 1-alpha
  KO
K09371  LIM homeobox transcription factor 1
Organism
gga  Gallus gallus (chicken)
Brite
KEGG Orthology (KO) [BR:gga00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:gga03000]
    777133 (LMX1A)
Transcription factors [BR:gga03000]
 Eukaryotic type
  Helix-turn-helix
   Homeo domain with LIM region
    777133 (LMX1A)
SSDB
Motif
Pfam: LIM Homeodomain Homeobox_KN
Other DBs
NCBI-GeneID: 777133
NCBI-ProteinID: NP_001244317
CGNC: 58630
Ensembl: ENSGALG00000003424
UniProt: E1C2D6
Position
8
AA seq 380 aa
MLDGLKMEETLQSALDPAAPFSSLLGRAATPRSVCEGCQRVIADRFLLRLNDSLWHERCV
QCTSCKEPLHTTCFYRDKKLYCKLDYEKLFAVKCAGCLESIAPSELVMRAQQSVYHLHCF
CCCVCERRLQKGDEFVLKEGQLLCKGDYEKERELLSLVSPALSDSGKSDDEDSVCKMGPA
SAKGAEEGKDHKRPKRPRTILTTQQRRAFKASFEVSSKPCRKVRETLAAETGLSVRVVQV
WFQNQRAKMKKLARRQQQQQQDQQNTQRLSSAQPNSSGPGGLEGLMNPYTALQPPQQLLG
MEQVYSSDPFRQGLTPPQMPGDHMHPYGAEPLFHDMDSDDTSLSNLGDCFLATADAGPLQ
TRAGNPIDHLYSMQSSYFTS
NT seq 1143 nt   +upstreamnt  +downstreamnt
atgctggacggcttgaagatggaggagactttgcagagcgccctggaccccgccgccccc
ttctcctcgctgctgggcagagccgcgacgccccgctccgtgtgtgaggggtgccagcgg
gtcatcgccgaccgcttcctcctgcgcctcaacgacagcctgtggcacgagcgctgcgtg
cagtgcacgtcgtgcaaggagcccctgcacaccacctgcttctaccgagacaagaagctc
tactgcaagctggactacgagaagttgttcgcagtgaagtgcgccgggtgcctggagagc
atcgcgcccagcgagctggtgatgcgcgcccagcagagcgtctaccacctgcactgcttc
tgctgctgcgtctgcgagcggcgcctgcagaagggcgatgagttcgtgctgaaggaaggg
cagctgctctgtaagggcgactacgagaaggagcgtgagctgctgagcttggtgagcccg
gctctgtcggattccggtaaaagtgacgatgaagacagtgtctgcaaaatgggcccagcc
tcagcaaagggagctgaggaggggaaggaccacaagcggcccaagcgcccgcgcaccatc
ctgaccacgcaacagcgcagggccttcaaggcgtccttcgaggtctcctccaagccctgc
aggaaggtgcgggagacactggcagccgagacagggctgagcgtgcgcgtggtgcaggtc
tggttccagaaccagagagcaaagatgaagaagctggccaggaggcagcagcagcagcag
caggaccagcagaacacgcagcgcttgagctcagcccagccgaacagcagtggccctggg
gggctggaggggcttatgaacccctacactgctctgcaacccccacagcagctcctgggc
atggagcaggtctacagctccgaccccttccggcaagggctcacccccccacagatgcct
ggagaccacatgcacccctatggtgctgagcccctcttccatgacatggacagcgacgat
acctcactgagcaacctgggtgactgcttcctcgccacagcagatgcggggccactgcag
acacgggcggggaaccccatcgaccacctgtactccatgcagagctcctacttcacctcc
tga

DBGET integrated database retrieval system