KEGG   Gallus gallus (chicken): 777548
Entry
777548            CDS       T01006                                 

Gene name
HOXB6
Definition
(RefSeq) homeobox protein Hox-B6 isoform X2
  KO
K09306  homeobox protein HoxA/B/C6
Organism
gga  Gallus gallus (chicken)
Brite
KEGG Orthology (KO) [BR:gga00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:gga03000]
    777548 (HOXB6)
Transcription factors [BR:gga03000]
 Eukaryotic type
  Helix-turn-helix
   Homeo domain only, Antp
    777548 (HOXB6)
SSDB
Motif
Pfam: Homeodomain Homeobox_KN DUF2209
Other DBs
NCBI-GeneID: 777548
NCBI-ProteinID: XP_015154927
CGNC: 59035
Ensembl: ENSGALG00000037619
UniProt: A0A1D5PZQ6
Position
27
AA seq 222 aa
MSSYFVNSTFPVSLAAGQEPFLGQIPLYPSGYADPLRHYPSTYGATGVQEKGYASSPYYQ
QSNGAYSRSSACDYGAGGFFREKDPACPPPNLDEVPFAPEPRKSDCAQSKTVFGESEEQK
CSAPVYPWMQRMNSCNSSSFGPSGRRGRQTYTRYQTLELEKEFHFNRYLTRRRRIEIAHS
LCLTERQIKIWFQNRRMKWKKENKLLSSSQLSAEEEEEKTAE
NT seq 669 nt   +upstreamnt  +downstreamnt
atgagttcttattttgtcaactcgaccttcccggtgagtctggcggcggggcaggagccc
ttcctgggacagatcccgttatatccctcgggctatgcggatcctttgaggcactacccc
agcacctatggagccacgggagtccaggagaagggctatgcctcctctccctactaccag
caaagcaacggagcctacagccgcagctccgcctgtgactatggggccggcggctttttc
agggagaaggaccctgcgtgccccccccccaacctggacgaggtccccttcgcccccgag
ccgcgcaagtcggactgcgcgcagagcaaaactgtgttcggagagagcgaggagcaaaag
tgttccgccccggtttacccctggatgcagcggatgaactcttgcaatagttcctccttc
gggcccagcggccgcagaggccgtcagacgtacacccgttaccaaaccctggagctggag
aaggaattccacttcaaccgctacctgacccggcgccggcggatcgagatcgcccactcg
ctctgtctgacggaacggcagatcaagatctggttccagaaccgtcggatgaagtggaaa
aaagagaacaaactgctcagctcctcgcagctgagcgcggaggaggaggaggagaaaacg
gcggagtga

DBGET integrated database retrieval system