KEGG   Gallus gallus (chicken): 417950Help
Entry
417950            CDS       T01006                                 

Gene name
HIST2H4B
Definition
(RefSeq) histone H4
  KO
K11254  histone H4
Organism
gga  Gallus gallus (chicken)
Brite
KEGG Orthology (KO) [BR:gga00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:gga03036]
    417950 (HIST2H4B)
Chromosome and associated proteins [BR:gga03036]
 Eukaryotic Type
  Nucleosome assembly factors
   Histones
    417950 (HIST2H4B)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: CENP-T_C TAF CENP-S Histone CBFD_NFYB_HMF TFIID-31kDa Bromo_TP UPF0137
Motif
Other DBs
NCBI-GeneID: 417950
NCBI-ProteinID: NP_001032932
CGNC: 50630
Ensembl: ENSGALG00000032198
UniProt: P62801
Structure
PDB: 

Position
1
AA seq 103 aa AA seqDB search
MSGRGKGGKGLGKGGAKRHRKVLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLK
VFLENVIRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYGFGG
NT seq 312 nt NT seq  +upstreamnt  +downstreamnt
atgtctggcagaggcaagggcgggaaggggctcggcaagggcggcgccaagcgccaccgc
aaggtgctgcgcgacaacatccagggcatcaccaagccggccatccgccgcctggcgcgg
cgcggcggcgtcaagcgcatctcggggctcatctacgaggagacgcgcggcgtgctcaag
gtcttcctggagaacgtcatccgcgacgccgtcacctacaccgagcacgccaagaggaag
acggtcacggccatggacgtggtctacgcgctcaagcgccagggacgcaccctctacggc
ttcggcggctaa

DBGET integrated database retrieval system