KEGG   Geobacillus sp. GHH01: GHH_c01340Help
Entry
GHH_c01340        CDS       T02455                                 

Gene name
rplV
Definition
(GenBank) 50S ribosomal protein L22
  KO
K02890  large subunit ribosomal protein L22
Organism
ggh  Geobacillus sp. GHH01
Pathway
ggh03010  Ribosome
Brite
KEGG Orthology (KO) [BR:ggh00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    GHH_c01340 (rplV)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:ggh03011]
    GHH_c01340 (rplV)
Ribosome [BR:ggh03011]
 Ribosomal proteins
  Mitochondria/ Chloroplast
   Large subunit
    GHH_c01340 (rplV)
  Bacteria
    GHH_c01340 (rplV)
  Archaea
    GHH_c01340 (rplV)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ribosomal_L22
Motif
Other DBs
NCBI-ProteinID: AGE20727
UniProt: L7ZUI8
Position
132586..132927
Genome map
AA seq 113 aa AA seqDB search
MQAKAVARTVRIAPRKARLVIDLIRGKEVGEAFAILRHTPKAASPIIEKVLKSAVANAEH
NYDMDVNNLVITQAYVDEGPTLKRFRPRAMGRASAINKRTSHITIVVSEKKEG
NT seq 342 nt NT seq  +upstreamnt  +downstreamnt
atgcaagctaaagctgttgcaagaaccgttcgcatcgctcctcgtaaagcgcgcttagtc
attgacttgattcgcgggaaagaagtgggcgaagcgttcgctattttgcgccatacacca
aaagcagcttccccgatcattgagaaagtgttgaaatcagcagttgccaacgctgaacac
aactatgacatggacgtcaacaacttggtcattactcaagcgtatgtcgacgaaggcccg
acgctgaaacggttccgtccgcgcgccatgggacgggcaagcgccattaacaaacgcaca
agccatattacgatcgtcgtttcagaaaagaaggagggataa

DBGET integrated database retrieval system