KEGG   Geobacillus sp. GHH01: GHH_c16740Help
Entry
GHH_c16740        CDS       T02455                                 

Gene name
thlA2
Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
ggh  Geobacillus sp. GHH01
Pathway
ggh00071  Fatty acid degradation
ggh00072  Synthesis and degradation of ketone bodies
ggh00280  Valine, leucine and isoleucine degradation
ggh00310  Lysine degradation
ggh00362  Benzoate degradation
ggh00380  Tryptophan metabolism
ggh00620  Pyruvate metabolism
ggh00630  Glyoxylate and dicarboxylate metabolism
ggh00640  Propanoate metabolism
ggh00650  Butanoate metabolism
ggh00900  Terpenoid backbone biosynthesis
ggh01100  Metabolic pathways
ggh01110  Biosynthesis of secondary metabolites
ggh01120  Microbial metabolism in diverse environments
ggh01130  Biosynthesis of antibiotics
ggh01200  Carbon metabolism
ggh01212  Fatty acid metabolism
ggh02020  Two-component system
Brite
KEGG Orthology (KO) [BR:ggh00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    GHH_c16740 (thlA2)
   00630 Glyoxylate and dicarboxylate metabolism
    GHH_c16740 (thlA2)
   00640 Propanoate metabolism
    GHH_c16740 (thlA2)
   00650 Butanoate metabolism
    GHH_c16740 (thlA2)
  09103 Lipid metabolism
   00071 Fatty acid degradation
    GHH_c16740 (thlA2)
   00072 Synthesis and degradation of ketone bodies
    GHH_c16740 (thlA2)
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    GHH_c16740 (thlA2)
   00310 Lysine degradation
    GHH_c16740 (thlA2)
   00380 Tryptophan metabolism
    GHH_c16740 (thlA2)
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    GHH_c16740 (thlA2)
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    GHH_c16740 (thlA2)
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    GHH_c16740 (thlA2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:ggh04147]
    GHH_c16740 (thlA2)
Enzymes [BR:ggh01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     GHH_c16740 (thlA2)
Exosome [BR:ggh04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   GHH_c16740 (thlA2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt ACP_syn_III_C
Motif
Other DBs
NCBI-ProteinID: AGE22202
UniProt: L7ZYP7
Position
1673461..1674630
Genome map
AA seq 389 aa AA seqDB search
MKRDAVIVSAVRTAIARQGGALATMPAHIYGAEVIKEAMRRANIGPEHVDDVIMGNVLSG
GGNIARLTALQTGLSLELTGLTVDRQCGSGINAVNLAAQAIWAGDGDVYIAGGVESMSRA
PYLMDRPEKPYSSTPPSFRKSQLSPKEIGDPPMGITAENLAKKYGISREEQDAFALRSQQ
RMARAMQEGRFDEQIVPITVPVKKGEPFVFDTDEHPRPNTTMEALSKLPPAFLEGGTVTA
GNSSGLNDAASALVIMSREKAEELGVKPLAVIRAHAVAGVDPNIMGIGPVPATRKVLEKV
GLTLDDMDIIEINEAFAAQVIACDRELEMDPEKVNVNGGAIAHGHPLGATGAILITKAVY
ELKRRGGKYALITACIGGGQGIATIIERE
NT seq 1170 nt NT seq  +upstreamnt  +downstreamnt
atgaaacgggatgccgtcattgtgtcggccgtacgaacagccatcgcccgccaaggaggc
gctttggcgacgatgccggcgcatatttacggcgcggaagtgatcaaagaagcgatgcgg
cgggcgaatatcggcccggagcatgtcgatgatgtcattatgggcaacgtcctaagcggc
ggcggcaacatcgcccgactgacggcgctgcaaaccggcttatctctagagttgacaggt
ttgaccgttgaccgccaatgcggttcgggcattaacgccgtcaatttagcggcgcaagcc
atttgggccggcgacggagacgtgtatatcgccggcggcgtggaaagcatgagccgcgcg
ccgtatttgatggaccgcccggaaaaaccgtacagctcaacaccgccaagcttccgcaaa
tcgcagctatcgccgaaagaaatcggcgatccgccgatggggattacggcggaaaacttg
gcgaaaaagtatggcatcagccgtgaagaacaagacgcattcgccttgcgcagccaacag
cgcatggcgcgcgccatgcaggaagggcggtttgacgaacaaatcgtgccgatcaccgtc
ccggtgaaaaaaggcgagccgttcgtcttcgatacggatgaacatccgcgcccgaatacg
acgatggaagcgctgtcgaagctgccgccggcgtttttggaagggggaacggtgacggcc
ggaaacagctcagggctgaacgatgccgcttctgcgctcgtcatcatgtcgcgggaaaaa
gcagaggagcttggcgtaaagccgcttgccgtcatccgcgcccatgcggttgccggggtc
gacccgaacatcatgggcatcggcccggtgccggcgacaagaaaagtgctcgaaaaagtc
gggcttacgctcgatgatatggacatcatcgaaatcaatgaagctttcgccgcccaggtg
atcgcctgcgaccgcgagctcgagatggacccggaaaaagtgaatgtcaacggcggcgcc
attgcccacggccatccgcttggcgcgacgggagcgattttgatcacaaaagcggtgtat
gaactgaagcgccgtggagggaaatacgcgctcattaccgcgtgcatcggcggcggccaa
ggcattgcgacgattattgaacgagaatga

DBGET integrated database retrieval system