KEGG   Geobacillus sp. GHH01: GHH_c23030Help
Entry
GHH_c23030        CDS       T02455                                 

Gene name
folE
Definition
(GenBank) GTP cyclohydrolase I
  KO
K01495  GTP cyclohydrolase IA [EC:3.5.4.16]
Organism
ggh  Geobacillus sp. GHH01
Pathway
ggh00790  Folate biosynthesis
ggh01100  Metabolic pathways
Module
ggh_M00126  Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:ggh00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    GHH_c23030 (folE)
Enzymes [BR:ggh01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.4  In cyclic amidines
    3.5.4.16  GTP cyclohydrolase I
     GHH_c23030 (folE)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GTP_cyclohydroI QueF BCDHK_Adom3 EccE Adeno_GP19K
Motif
Other DBs
NCBI-ProteinID: AGE22814
UniProt: L7ZZY9
Position
complement(2317074..2317640)
Genome map
AA seq 188 aa AA seqDB search
MPEINFAQIEYAVRLILEAIGEDPNREGLVDTPKRVAKMYAEVFAGLQEDPKQHFQTVFS
EEHEELVLVKDIPFYSMCEHHLVPFFGAAHVAYIPREGKVTGLSKLARAVEAVARRPQLQ
ERITATIADSIVEALEPHGVMVVVEAEHMCMTMRGVKKPGSKTVTTAVRGVFETDANARA
EVLSLIKA
NT seq 567 nt NT seq  +upstreamnt  +downstreamnt
atgccagagatcaattttgcgcaaattgaatatgcggtccgcctcattcttgaggcgatc
ggggaagatccaaaccgcgaagggctcgtcgatacgccgaagagggtggcgaaaatgtat
gccgaggtgttcgctgggctgcaggaagacccgaagcaacactttcaaaccgtattcagc
gaggaacatgaggagcttgtgctcgtcaaagatattccgttttattcgatgtgcgaacac
catttagtgccgttttttggcgctgcccacgtcgcctatattccgcgggaagggaaagtg
accgggctgagcaagctcgctcgagccgttgaggcggtggcgcgccgcccgcagctgcaa
gagcgcatcacggcaacgatcgctgattcgatcgtcgaggcgcttgagccgcatggggtg
atggtcgttgttgaggcggagcatatgtgcatgacgatgcgcggggtgaaaaaaccgggg
tccaaaacagtgacgacagcggtgcgcggcgtgtttgaaacagatgccaacgcccgcgct
gaagtgctttcgttaatcaaagcgtaa

DBGET integrated database retrieval system