KEGG   Geobacillus sp. GHH01: GHH_c27220Help
Entry
GHH_c27220        CDS       T02455                                 

Gene name
hemD
Definition
(GenBank) uroporphyrinogen-III synthase
  KO
K01719  uroporphyrinogen-III synthase [EC:4.2.1.75]
Organism
ggh  Geobacillus sp. GHH01
Pathway
ggh00860  Porphyrin and chlorophyll metabolism
ggh01100  Metabolic pathways
ggh01110  Biosynthesis of secondary metabolites
ggh01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:ggh00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    GHH_c27220 (hemD)
Enzymes [BR:ggh01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.75  uroporphyrinogen-III synthase
     GHH_c27220 (hemD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HEM4 DUF4761
Motif
Other DBs
NCBI-ProteinID: AGE23233
UniProt: L7ZUN3
Position
complement(2711040..2711807)
Genome map
AA seq 255 aa AA seqDB search
MIHSALAGKTVLVTRGKEQAASFSAKLRAVGAVPVEIPLIAIRPAAPEEIASMVERLGEY
RWLVFTSANAVRFFFPHVSLPRPLPEMAVVGRKTAAALAEHGLSPALVPDDYTAERLADL
LMPRVKQGDRVLFVKGNLARPTLPEALRNAGAAVDELTVYETEPDENGRERLLSLLRRRE
LDAVTLMSPSAVDSLVRLLDKEVDALLSGVAVACIGPVTKEAAERAGIPVHICPTDYTTD
GIIKAMEQYFSMEGR
NT seq 768 nt NT seq  +upstreamnt  +downstreamnt
atgatacacagcgcgctcgccggcaaaacggtgcttgtgacgcgcggcaaagagcaggcg
gcatcgttttctgccaagctgcgcgctgtcggcgccgtgccggtcgagatcccgctcatt
gccatccgaccggcggcgccggaagaaatcgcttctatggttgagcggcttggcgaatac
cgttggctcgttttcacaagcgcgaacgccgtccgcttcttttttccgcacgtttcgttg
ccgcggccgctgccggagatggctgtcgtcggccggaaaacagcggcggcgctcgccgag
catggtctttccccggcgcttgtgccggatgattacaccgctgaacggctggctgacttg
ctcatgccgcgcgtcaaacaaggcgaccgggtgctgtttgtcaaaggcaatttggcgcgc
ccgaccttgcctgaggcgttgcgaaacgccggcgccgcggtcgacgagctcacggtgtat
gagaccgagcctgatgaaaacggccgggagcggttgttgtcgctgctgcgccggcgggag
cttgatgcggtcaccttgatgagcccgtcggcggttgacagccttgtccgccttctcgac
aaagaagtggatgcccttctttccggtgttgcggtcgcctgcatcggaccggtgacgaaa
gaagcggccgagcgggcgggcattccggtccatatttgtccgacggattacaccacggat
ggtataatcaaagcgatggaacaatatttttccatggagggacgatga

DBGET integrated database retrieval system