KEGG   Geobacillus sp. GHH01: GHH_c30410Help
Entry
GHH_c30410        CDS       T02455                                 

Gene name
thrC2
Definition
(GenBank) threonine synthase
  KO
K01733  threonine synthase [EC:4.2.3.1]
Organism
ggh  Geobacillus sp. GHH01
Pathway
ggh00260  Glycine, serine and threonine metabolism
ggh00750  Vitamin B6 metabolism
ggh01100  Metabolic pathways
ggh01110  Biosynthesis of secondary metabolites
ggh01120  Microbial metabolism in diverse environments
ggh01230  Biosynthesis of amino acids
Module
ggh_M00018  Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:ggh00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    GHH_c30410 (thrC2)
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    GHH_c30410 (thrC2)
Enzymes [BR:ggh01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     GHH_c30410 (thrC2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PALP TPR_14
Motif
Other DBs
NCBI-ProteinID: AGE23533
UniProt: L7ZVK2
Position
complement(3031775..3032836)
Genome map
AA seq 353 aa AA seqDB search
MAWKGLLDAYGDFLPLSAATPRLSLCEGNTPLIPLPRLSEELGIALYVKVEGANPTGSFK
DRGMVMAVAKAKEEGSHTIICASTGNTSASAAAYAARAGMRCLVVVPNGKIALGKLAQAA
MYGAEIFAIDGNFDEALKMVRRLSETAPITLVNSVNPYRIEGQKTAAFEVCDQLGRAPDV
LAIPVGNAGNITAYWKGFKEYHGAKGTGLPQMRGFEAEGAAAIVRNRVIEQPETVATAIR
IGNPASWDKAVEAASESRGKIDEVSDAEILAAYKRLARTEGIFAEPASCAAIAGVIKQRE
RNEIERGSLVVAVLTGNGLKDPAIALETAAIEPIVLPNDEQVVLEHLQGVVRA
NT seq 1062 nt NT seq  +upstreamnt  +downstreamnt
atggcatggaaaggactgcttgacgcctacggcgattttttgccgctctctgcggcgacg
ccgaggctgtcgctttgcgaagggaatacgccgctcatcccgctgccgcgcttgtcggag
gagctcggcattgcgctctatgtcaaggtcgaaggggcgaacccgaccggttcgtttaaa
gaccgcggcatggtgatggcggtggccaaggcgaaagaggaaggaagccatacgatcatc
tgcgcctcaaccggcaatacatcggcttcagcggccgcctacgcggcgcgcgccggcatg
cgctgcctcgtcgtcgttccgaacggcaagatcgccctcggcaagttggcgcaagccgcc
atgtacggcgcggaaatttttgcgattgacggcaactttgacgaggcgctgaagatggtg
cgccggttgagcgaaacggcgccgattacgctcgtcaactcggtcaatccgtaccggatc
gaagggcaaaaaacggcggcgtttgaagtgtgcgaccagcttgggcgcgccccggacgtg
ctcgccattccagtcggcaacgccggcaacatcaccgcctattggaaagggtttaaggag
taccatggagcgaaaggaacgggcttgccgcaaatgcgcggctttgaagcggaaggagcg
gcggcgatcgtccgcaaccgggtgattgaacagccggagacggtggcgaccgcgatccgc
atcggcaatccggcgagctgggacaaagcggtcgaggcggcgagcgagtcgcgcgggaaa
attgatgaggtgagcgacgcagaaattttggccgcctacaagcggctcgcccggacggaa
ggcatttttgccgaaccggcgtcatgcgcggcgatcgccggggtgatcaagcagcgcgaa
cggaacgaaatcgaacgcggcagcctcgtcgtcgcggttctcactggcaacggattgaaa
gacccggccatcgccttggagaccgcggcgatcgaaccgatcgtgctgccgaacgatgaa
caagttgtcttggagcatttgcaaggggttgtccgggcatga

DBGET integrated database retrieval system