KEGG   Gorilla gorilla gorilla (western lowland gorilla): 101123728Help
Entry
101123728         CDS       T02442                                 

Gene name
CAMKK1
Definition
(RefSeq) calcium/calmodulin dependent protein kinase kinase 1
  KO
K00908  calcium/calmodulin-dependent protein kinase kinase 1 [EC:2.7.11.17]
Organism
ggo  Gorilla gorilla gorilla (western lowland gorilla)
Pathway
ggo05034  Alcoholism
Brite
KEGG Orthology (KO) [BR:ggo00001]
 09160 Human Diseases
  09165 Substance dependence
   05034 Alcoholism
    101123728 (CAMKK1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:ggo01001]
    101123728 (CAMKK1)
Enzymes [BR:ggo01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.17  Ca2+/calmodulin-dependent protein kinase
     101123728 (CAMKK1)
Protein kinases [BR:ggo01001]
 Serine/threonine kinases: Other
  CAMKK family
   101123728 (CAMKK1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr Kinase-like Pkinase_fungal
Motif
Other DBs
NCBI-GeneID: 101123728
NCBI-ProteinID: XP_004058350
Ensembl: ENSGGOG00000003068
UniProt: G3QKN7
Position
17
AA seq 520 aa AA seqDB search
MEGGPAVCCQDPRAELVERVAAIDVTHLEEADGGPEPTRNGVDPPPRARAASVIPGSTSR
LLPARPSLSARKLSLQERPAGSYLEAQAGPYATGPASHISPRAWRRPTIESHHVAISDAE
DCVQLNQYKLQSEIGKGAYGVVRLAYNESEDRHYAMKVLSKKKLLKQYGFPRRPPPRGSQ
AAQGGPAKQLLPLERVYQEIAILKKLDHVNVVKLIEVLDDPAEDNLYLALQNQAQNIQLD
STNIAKPQSLLPSEQQDSGSTWAVRSVFDLLRKGPVMEVPCDKPFSEEQARLYLRDVILG
LEYLHCQKIVHRDIKPSNLLLGDDGHVKIADFGVSNQFEGNDAQLSSTAGTPAFMAPEAI
SDSGQSFSGKALDVWATGVTLYCFVYGKCPFIDDFILALHRKIKNEPVVFPEEPEISEEL
KDLILKMLDKNPETRIGVPDIKLHPWVTRNGEEPLPSEEEHCSVVEVTEEEVKNSVRLIP
SWTTVILVKSMLRKRSFGNPFEPQARREERSMSAPGNLLV
NT seq 1563 nt NT seq  +upstreamnt  +downstreamnt
atggaggggggtccagctgtctgctgccaggatcctcgggcagagctggtagaacgggtg
gcagccatcgatgtgactcacttggaggaggcagatggtggcccagagcctactagaaac
ggtgtggaccctccgccacgggccagagctgcctctgtgatccctggcagtacttcaaga
ctgctcccagcccggcctagcctctcagccaggaagctttccctacaggagcggccagca
ggaagctatctggaggcgcaggctgggccttatgccacggggcctgccagccacatctcc
ccccgggcctggcggaggcccaccatcgagtcccaccacgtggccatctcagatgcagag
gactgcgtgcagctgaaccagtacaagctgcagagtgagattggcaagggtgcctacggt
gtggtgaggctggcctacaacgaaagtgaagacagacactatgcaatgaaagtcctttcc
aaaaagaagttactgaagcagtatggctttccacgtcgccctcccccgagagggtcccag
gctgcccagggaggaccagccaagcagctgctgcccctggagcgggtgtaccaggagatt
gccatcctgaagaagctggaccatgtgaatgtggtcaaactgatcgaggtcctggatgac
ccagctgaggacaacctctatttggccctgcagaaccaggcccagaatatccagttagat
tcaacaaatattgccaagccccaatccctgcttccctctgagcagcaagacagtggatcc
acgtgggctgtgcgctcagtgtttgacctcctgagaaaggggcccgtcatggaagtgccc
tgtgacaagcccttctcggaggagcaagctcgcctttacctgcgggacgtcatcctgggc
ctcgagtacttgcactgccagaagatcgtccacagggacatcaagccatccaacctgctc
ctgggggatgatgggcacgtgaagatcgccgactttggcgtcagcaaccagtttgagggg
aacgacgctcagctgtccagcacggcgggaaccccagcattcatggcccccgaggccatt
tctgattccggccagagcttcagtgggaaggccttggatgtatgggccaccggcgtcacg
ttgtactgctttgtctatgggaagtgcccattcatcgacgatttcatcctggccctccac
aggaagatcaagaatgagcccgtggtgtttcctgaggagccagaaatcagcgaggagctc
aaggacctgatcctgaagatgttagacaagaatcctgagacgagaattggggtgccagac
atcaagttgcacccttgggtgaccaggaacggggaggagccccttccttcggaggaggag
cactgcagcgtggtggaggtgacagaggaggaggttaagaactcagtcagactcatcccc
agctggaccacggtgatcctggtgaagtccatgctgaggaagcgttcctttgggaacccg
tttgagccccaagcacggagggaagagcgatccatgtctgctccaggaaacctactggtg
taa

DBGET integrated database retrieval system